Cargando…

Assessment of adolescent and youth friendly services in primary healthcare facilities in two provinces in South Africa

BACKGROUND: Health services for adolescents are increasingly recognised as a priority in low- and middle-income countries (LMICs). The Adolescent and Youth Friendly Service (AYFS) approach has been promoted in South Africa by the National Department of Health and partners, as a means of standardisin...

Descripción completa

Detalles Bibliográficos
Autores principales: James, Shamagonam, Pisa, Pedro T., Imrie, John, Beery, Moira P., Martin, Catherine, Skosana, Catherine, Delany-Moretlwe, Sinead
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6198437/
https://www.ncbi.nlm.nih.gov/pubmed/30348166
http://dx.doi.org/10.1186/s12913-018-3623-7
_version_ 1783364966499221504
author James, Shamagonam
Pisa, Pedro T.
Imrie, John
Beery, Moira P.
Martin, Catherine
Skosana, Catherine
Delany-Moretlwe, Sinead
author_facet James, Shamagonam
Pisa, Pedro T.
Imrie, John
Beery, Moira P.
Martin, Catherine
Skosana, Catherine
Delany-Moretlwe, Sinead
author_sort James, Shamagonam
collection PubMed
description BACKGROUND: Health services for adolescents are increasingly recognised as a priority in low- and middle-income countries (LMICs). The Adolescent and Youth Friendly Service (AYFS) approach has been promoted in South Africa by the National Department of Health and partners, as a means of standardising the quality of adolescent health services in the country. The objective of this paper is to detail the evaluation of AYFS against defined standards to inform initiatives for strengthening these services. METHODS: A cross-sectional assessment of AYFS was carried out in 14 healthcare facilities in a sub-district of Gauteng Province and 16 in a sub-district in North West Province, South Africa. Data on adolescent care and service management systems were collected through interviews with healthcare providers, non-clinical staff and document review. Responses were scored using a tool based on national and World Health Organisation criteria for ten AYFS standards. RESULTS: Mean scores for the ten standards showed substantial variation across facilities in the two sub-Districts, with Gauteng Province scoring lower than the North West for 9 standards. The sub-district median for Gauteng was 38% and the North West 48%. In both provinces standards related to the general service delivery, such as Standards 4 and 5, scored above 75%. Assessment of services specifically addressing sexual, reproductive and mental health (Standard 3) showed that almost all these services were scored above 50%. Exploration of services related to psycho-social and physical assessments (Standard 8) demonstrated differences in the healthcare facilities’ management of adolescents’ presenting complaints and their comprehensive management including psycho-social status and risk profile. Additionally, none of the facilities in either sub-district was able to meet the minimum criteria for the five standards required for AYFS recognition. CONCLUSION: Facilities had the essential components for general service delivery in place, but adolescent-specific service provision was lacking. AYFS is a government priority, but additional support for facilities is needed to achieve the agreed standards. Meeting these standards could make a major contribution to securing adolescents’ health, especially in preventing unintended pregnancies and HIV as well as improving psycho-social management. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12913-018-3623-7) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-6198437
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-61984372018-10-31 Assessment of adolescent and youth friendly services in primary healthcare facilities in two provinces in South Africa James, Shamagonam Pisa, Pedro T. Imrie, John Beery, Moira P. Martin, Catherine Skosana, Catherine Delany-Moretlwe, Sinead BMC Health Serv Res Research Article BACKGROUND: Health services for adolescents are increasingly recognised as a priority in low- and middle-income countries (LMICs). The Adolescent and Youth Friendly Service (AYFS) approach has been promoted in South Africa by the National Department of Health and partners, as a means of standardising the quality of adolescent health services in the country. The objective of this paper is to detail the evaluation of AYFS against defined standards to inform initiatives for strengthening these services. METHODS: A cross-sectional assessment of AYFS was carried out in 14 healthcare facilities in a sub-district of Gauteng Province and 16 in a sub-district in North West Province, South Africa. Data on adolescent care and service management systems were collected through interviews with healthcare providers, non-clinical staff and document review. Responses were scored using a tool based on national and World Health Organisation criteria for ten AYFS standards. RESULTS: Mean scores for the ten standards showed substantial variation across facilities in the two sub-Districts, with Gauteng Province scoring lower than the North West for 9 standards. The sub-district median for Gauteng was 38% and the North West 48%. In both provinces standards related to the general service delivery, such as Standards 4 and 5, scored above 75%. Assessment of services specifically addressing sexual, reproductive and mental health (Standard 3) showed that almost all these services were scored above 50%. Exploration of services related to psycho-social and physical assessments (Standard 8) demonstrated differences in the healthcare facilities’ management of adolescents’ presenting complaints and their comprehensive management including psycho-social status and risk profile. Additionally, none of the facilities in either sub-district was able to meet the minimum criteria for the five standards required for AYFS recognition. CONCLUSION: Facilities had the essential components for general service delivery in place, but adolescent-specific service provision was lacking. AYFS is a government priority, but additional support for facilities is needed to achieve the agreed standards. Meeting these standards could make a major contribution to securing adolescents’ health, especially in preventing unintended pregnancies and HIV as well as improving psycho-social management. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12913-018-3623-7) contains supplementary material, which is available to authorized users. BioMed Central 2018-10-22 /pmc/articles/PMC6198437/ /pubmed/30348166 http://dx.doi.org/10.1186/s12913-018-3623-7 Text en © The Author(s). 2018 Open Access This article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
James, Shamagonam
Pisa, Pedro T.
Imrie, John
Beery, Moira P.
Martin, Catherine
Skosana, Catherine
Delany-Moretlwe, Sinead
Assessment of adolescent and youth friendly services in primary healthcare facilities in two provinces in South Africa
title Assessment of adolescent and youth friendly services in primary healthcare facilities in two provinces in South Africa
title_full Assessment of adolescent and youth friendly services in primary healthcare facilities in two provinces in South Africa
title_fullStr Assessment of adolescent and youth friendly services in primary healthcare facilities in two provinces in South Africa
title_full_unstemmed Assessment of adolescent and youth friendly services in primary healthcare facilities in two provinces in South Africa
title_short Assessment of adolescent and youth friendly services in primary healthcare facilities in two provinces in South Africa
title_sort assessment of adolescent and youth friendly services in primary healthcare facilities in two provinces in south africa
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6198437/
https://www.ncbi.nlm.nih.gov/pubmed/30348166
http://dx.doi.org/10.1186/s12913-018-3623-7
work_keys_str_mv AT jamesshamagonam assessmentofadolescentandyouthfriendlyservicesinprimaryhealthcarefacilitiesintwoprovincesinsouthafrica
AT pisapedrot assessmentofadolescentandyouthfriendlyservicesinprimaryhealthcarefacilitiesintwoprovincesinsouthafrica
AT imriejohn assessmentofadolescentandyouthfriendlyservicesinprimaryhealthcarefacilitiesintwoprovincesinsouthafrica
AT beerymoirap assessmentofadolescentandyouthfriendlyservicesinprimaryhealthcarefacilitiesintwoprovincesinsouthafrica
AT martincatherine assessmentofadolescentandyouthfriendlyservicesinprimaryhealthcarefacilitiesintwoprovincesinsouthafrica
AT skosanacatherine assessmentofadolescentandyouthfriendlyservicesinprimaryhealthcarefacilitiesintwoprovincesinsouthafrica
AT delanymoretlwesinead assessmentofadolescentandyouthfriendlyservicesinprimaryhealthcarefacilitiesintwoprovincesinsouthafrica