Cargando…
Risky behaviours and their correlates among adolescents living with HIV in sub-Saharan Africa: a systematic review
BACKGROUND: Adolescents living with HIV (ALWHIV) in sub-Saharan Africa encounter multiple health problems that are often unrecognised by the public and the healthcare workforce. The aim of this systematic review was to identify risky health behaviours and their associated factors among ALWHIV in sub...
Autores principales: | , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6201550/ https://www.ncbi.nlm.nih.gov/pubmed/30355344 http://dx.doi.org/10.1186/s12978-018-0614-4 |
_version_ | 1783365527421321216 |
---|---|
author | Zgambo, Maggie Kalembo, Fatch Welcome Mbakaya, Balwani Chingatichifwe |
author_facet | Zgambo, Maggie Kalembo, Fatch Welcome Mbakaya, Balwani Chingatichifwe |
author_sort | Zgambo, Maggie |
collection | PubMed |
description | BACKGROUND: Adolescents living with HIV (ALWHIV) in sub-Saharan Africa encounter multiple health problems that are often unrecognised by the public and the healthcare workforce. The aim of this systematic review was to identify risky health behaviours and their associated factors among ALWHIV in sub-Saharan Africa. METHODS: We systematically searched for articles in Medline, SCOPUS, Directory of Open Access Journals, Science Direct, ProQuest, Psych-info, Web of science, WHO Global Index Medicus library, Cochrane, and Google Scholar. Studies were included in this review if: they were original studies; participants were aged from 10 to 19 years; participants were ALWHIV or they had data from different key informants focusing on ALWHIV within the age group; they had health behaviours as an outcome; they were conducted in sub-Saharan Africa and were published before December 2016. Data were extracted and the quality of the studies was appraised using the Mixed Method Appraisal Tool (MMAT). RESULTS: Thirty-six studies met the eligibility criteria. Nineteen studies scored 100% (indicating high quality), sixteen studies scored 75% (indicating moderate quality) and one study scored 50% (indicating low quality) on the MMAT scale. Adherence to antiretroviral therapy among ALWHIV was suboptimal and was negatively affected by forgetfulness, opportunistic infection, long distance to clinics, and fear of unplanned disclosure. Many adolescents were sexually active, but the majority did not disclose their HIV status to sexual partners, despite knowing their diagnosis (range 76–100% across available studies) and some did not use protection (condoms) to prevent transmission of HIV and other sexually transmitted diseases (range 35–55%). Disclosure to and from adolescents was low across the studies and was associated with fear of disclosure aftermaths including stigma and discrimination (range 40–57%). CONCLUSION: A considerable proportion of ALWHIV in sub-Saharan Africa engage in multiple risky health behaviours, which have a substantial negative impact on their wellbeing and cause significant risk and burden to their families, sexual partners and societies. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12978-018-0614-4) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-6201550 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-62015502018-10-31 Risky behaviours and their correlates among adolescents living with HIV in sub-Saharan Africa: a systematic review Zgambo, Maggie Kalembo, Fatch Welcome Mbakaya, Balwani Chingatichifwe Reprod Health Review BACKGROUND: Adolescents living with HIV (ALWHIV) in sub-Saharan Africa encounter multiple health problems that are often unrecognised by the public and the healthcare workforce. The aim of this systematic review was to identify risky health behaviours and their associated factors among ALWHIV in sub-Saharan Africa. METHODS: We systematically searched for articles in Medline, SCOPUS, Directory of Open Access Journals, Science Direct, ProQuest, Psych-info, Web of science, WHO Global Index Medicus library, Cochrane, and Google Scholar. Studies were included in this review if: they were original studies; participants were aged from 10 to 19 years; participants were ALWHIV or they had data from different key informants focusing on ALWHIV within the age group; they had health behaviours as an outcome; they were conducted in sub-Saharan Africa and were published before December 2016. Data were extracted and the quality of the studies was appraised using the Mixed Method Appraisal Tool (MMAT). RESULTS: Thirty-six studies met the eligibility criteria. Nineteen studies scored 100% (indicating high quality), sixteen studies scored 75% (indicating moderate quality) and one study scored 50% (indicating low quality) on the MMAT scale. Adherence to antiretroviral therapy among ALWHIV was suboptimal and was negatively affected by forgetfulness, opportunistic infection, long distance to clinics, and fear of unplanned disclosure. Many adolescents were sexually active, but the majority did not disclose their HIV status to sexual partners, despite knowing their diagnosis (range 76–100% across available studies) and some did not use protection (condoms) to prevent transmission of HIV and other sexually transmitted diseases (range 35–55%). Disclosure to and from adolescents was low across the studies and was associated with fear of disclosure aftermaths including stigma and discrimination (range 40–57%). CONCLUSION: A considerable proportion of ALWHIV in sub-Saharan Africa engage in multiple risky health behaviours, which have a substantial negative impact on their wellbeing and cause significant risk and burden to their families, sexual partners and societies. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12978-018-0614-4) contains supplementary material, which is available to authorized users. BioMed Central 2018-10-24 /pmc/articles/PMC6201550/ /pubmed/30355344 http://dx.doi.org/10.1186/s12978-018-0614-4 Text en © The Author(s). 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Review Zgambo, Maggie Kalembo, Fatch Welcome Mbakaya, Balwani Chingatichifwe Risky behaviours and their correlates among adolescents living with HIV in sub-Saharan Africa: a systematic review |
title | Risky behaviours and their correlates among adolescents living with HIV in sub-Saharan Africa: a systematic review |
title_full | Risky behaviours and their correlates among adolescents living with HIV in sub-Saharan Africa: a systematic review |
title_fullStr | Risky behaviours and their correlates among adolescents living with HIV in sub-Saharan Africa: a systematic review |
title_full_unstemmed | Risky behaviours and their correlates among adolescents living with HIV in sub-Saharan Africa: a systematic review |
title_short | Risky behaviours and their correlates among adolescents living with HIV in sub-Saharan Africa: a systematic review |
title_sort | risky behaviours and their correlates among adolescents living with hiv in sub-saharan africa: a systematic review |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6201550/ https://www.ncbi.nlm.nih.gov/pubmed/30355344 http://dx.doi.org/10.1186/s12978-018-0614-4 |
work_keys_str_mv | AT zgambomaggie riskybehavioursandtheircorrelatesamongadolescentslivingwithhivinsubsaharanafricaasystematicreview AT kalembofatchwelcome riskybehavioursandtheircorrelatesamongadolescentslivingwithhivinsubsaharanafricaasystematicreview AT mbakayabalwanichingatichifwe riskybehavioursandtheircorrelatesamongadolescentslivingwithhivinsubsaharanafricaasystematicreview |