Cargando…

Barriers to access and utilization of emergency obstetric care at health facilities in sub-Saharan Africa: a systematic review of literature

BACKGROUND: Nearly 15% of pregnancies end in fatal perinatal obstetric complications including bleeding, infections, hypertension, obstructed labour and complications of abortion. Globally, an estimated 10.7 million women have died due to obstetric complications in the last two decades, and two thir...

Descripción completa

Detalles Bibliográficos
Autores principales: Geleto, Ayele, Chojenta, Catherine, Musa, Abdulbasit, Loxton, Deborah
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6234634/
https://www.ncbi.nlm.nih.gov/pubmed/30424808
http://dx.doi.org/10.1186/s13643-018-0842-2
_version_ 1783370735900688384
author Geleto, Ayele
Chojenta, Catherine
Musa, Abdulbasit
Loxton, Deborah
author_facet Geleto, Ayele
Chojenta, Catherine
Musa, Abdulbasit
Loxton, Deborah
author_sort Geleto, Ayele
collection PubMed
description BACKGROUND: Nearly 15% of pregnancies end in fatal perinatal obstetric complications including bleeding, infections, hypertension, obstructed labour and complications of abortion. Globally, an estimated 10.7 million women have died due to obstetric complications in the last two decades, and two thirds of these deaths occurred in sub-Saharan Africa. Though the majority of maternal mortalities can be prevented, different factors can hinder women’s access to emergency obstetric services. Therefore, this review is aimed at synthesizing current evidence on barriers to access and utilization of emergency obstetric care in sub-Saharan Africa. METHODS: Articles were searched from MEDLINE, CINAHL, EMBASE, and Maternity and Infant Care databases using predefined search terms and strategies. Articles published in English, between 2010 and 2017, were included. Two reviewers (AG and AM) independently screened the articles, and data extraction was conducted using the Joanna Briggs Institute data extraction format. The quality of the included studies was assessed using the Mixed Methods Appraisal Tool. The identified barriers were qualitatively synthesized and reported using the Three Delays analytical framework. The PRISMA checklist was employed to present the findings. RESULT: The search of the selected databases returned 3534 articles. After duplicates were removed and further screening undertaken, 37 studies fulfilled the inclusion criteria. The identified key barriers related to the first delay included younger age, illiteracy, lower income, unemployment, poor health service utilization, a lower level of assertiveness among women, poor knowledge about obstetric danger signs, and cultural beliefs. Poorly designed roads, lack of vehicles, transportation costs, and distance from facilities led to the second delay. Barriers related to the third delay included lack of emergency obstetric care services and supplies, shortage of trained staff, poor management of emergency obstetric care provision, cost of services, long waiting times, poor referral practices, and poor coordination among staff. CONCLUSIONS: A number of factors were found to hamper access to and utilization of emergency obstetric care among women in sub-Saharan Africa. These barriers are inter-dependent and occurred at multiple levels either at home, on the way to health facilities, or at the facilities. Therefore, country-specific holistic strategies including improvements to healthcare systems and the socio-economic status of women need to be strengthened. Further research should focus on the assessment of the third delay, as little is known about facility-readiness. SYSTEMATIC REVIEW REGISTRATION: PROSPERO CRD42017074102 ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13643-018-0842-2) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-6234634
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-62346342018-11-23 Barriers to access and utilization of emergency obstetric care at health facilities in sub-Saharan Africa: a systematic review of literature Geleto, Ayele Chojenta, Catherine Musa, Abdulbasit Loxton, Deborah Syst Rev Systematic Review Update BACKGROUND: Nearly 15% of pregnancies end in fatal perinatal obstetric complications including bleeding, infections, hypertension, obstructed labour and complications of abortion. Globally, an estimated 10.7 million women have died due to obstetric complications in the last two decades, and two thirds of these deaths occurred in sub-Saharan Africa. Though the majority of maternal mortalities can be prevented, different factors can hinder women’s access to emergency obstetric services. Therefore, this review is aimed at synthesizing current evidence on barriers to access and utilization of emergency obstetric care in sub-Saharan Africa. METHODS: Articles were searched from MEDLINE, CINAHL, EMBASE, and Maternity and Infant Care databases using predefined search terms and strategies. Articles published in English, between 2010 and 2017, were included. Two reviewers (AG and AM) independently screened the articles, and data extraction was conducted using the Joanna Briggs Institute data extraction format. The quality of the included studies was assessed using the Mixed Methods Appraisal Tool. The identified barriers were qualitatively synthesized and reported using the Three Delays analytical framework. The PRISMA checklist was employed to present the findings. RESULT: The search of the selected databases returned 3534 articles. After duplicates were removed and further screening undertaken, 37 studies fulfilled the inclusion criteria. The identified key barriers related to the first delay included younger age, illiteracy, lower income, unemployment, poor health service utilization, a lower level of assertiveness among women, poor knowledge about obstetric danger signs, and cultural beliefs. Poorly designed roads, lack of vehicles, transportation costs, and distance from facilities led to the second delay. Barriers related to the third delay included lack of emergency obstetric care services and supplies, shortage of trained staff, poor management of emergency obstetric care provision, cost of services, long waiting times, poor referral practices, and poor coordination among staff. CONCLUSIONS: A number of factors were found to hamper access to and utilization of emergency obstetric care among women in sub-Saharan Africa. These barriers are inter-dependent and occurred at multiple levels either at home, on the way to health facilities, or at the facilities. Therefore, country-specific holistic strategies including improvements to healthcare systems and the socio-economic status of women need to be strengthened. Further research should focus on the assessment of the third delay, as little is known about facility-readiness. SYSTEMATIC REVIEW REGISTRATION: PROSPERO CRD42017074102 ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13643-018-0842-2) contains supplementary material, which is available to authorized users. BioMed Central 2018-11-13 /pmc/articles/PMC6234634/ /pubmed/30424808 http://dx.doi.org/10.1186/s13643-018-0842-2 Text en © The Author(s). 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Systematic Review Update
Geleto, Ayele
Chojenta, Catherine
Musa, Abdulbasit
Loxton, Deborah
Barriers to access and utilization of emergency obstetric care at health facilities in sub-Saharan Africa: a systematic review of literature
title Barriers to access and utilization of emergency obstetric care at health facilities in sub-Saharan Africa: a systematic review of literature
title_full Barriers to access and utilization of emergency obstetric care at health facilities in sub-Saharan Africa: a systematic review of literature
title_fullStr Barriers to access and utilization of emergency obstetric care at health facilities in sub-Saharan Africa: a systematic review of literature
title_full_unstemmed Barriers to access and utilization of emergency obstetric care at health facilities in sub-Saharan Africa: a systematic review of literature
title_short Barriers to access and utilization of emergency obstetric care at health facilities in sub-Saharan Africa: a systematic review of literature
title_sort barriers to access and utilization of emergency obstetric care at health facilities in sub-saharan africa: a systematic review of literature
topic Systematic Review Update
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6234634/
https://www.ncbi.nlm.nih.gov/pubmed/30424808
http://dx.doi.org/10.1186/s13643-018-0842-2
work_keys_str_mv AT geletoayele barrierstoaccessandutilizationofemergencyobstetriccareathealthfacilitiesinsubsaharanafricaasystematicreviewofliterature
AT chojentacatherine barrierstoaccessandutilizationofemergencyobstetriccareathealthfacilitiesinsubsaharanafricaasystematicreviewofliterature
AT musaabdulbasit barrierstoaccessandutilizationofemergencyobstetriccareathealthfacilitiesinsubsaharanafricaasystematicreviewofliterature
AT loxtondeborah barrierstoaccessandutilizationofemergencyobstetriccareathealthfacilitiesinsubsaharanafricaasystematicreviewofliterature