Cargando…
A novel splicing mutation in the PKD1 gene causes autosomal dominant polycystic kidney disease in a Chinese family: a case report
BACKGROUND: Autosomal dominant polycystic kidney disease (ADPKD) is the most common monogenic renal disorder in humans, affecting 1 in 400 to 1000 individuals. Mutations PKD1 (which accounts for 85% of ADPKD and produces polycystin-1) and PKD2 (produces polycystin-2) are responsible for this disease...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6234645/ https://www.ncbi.nlm.nih.gov/pubmed/30424739 http://dx.doi.org/10.1186/s12881-018-0706-6 |
_version_ | 1783370738563022848 |
---|---|
author | Xu, Peiwen Huang, Sexing Li, Jie Zou, Yang Gao, Ming Kang, Ranran Yan, Junhao Gao, Xuan Gao, Yuan |
author_facet | Xu, Peiwen Huang, Sexing Li, Jie Zou, Yang Gao, Ming Kang, Ranran Yan, Junhao Gao, Xuan Gao, Yuan |
author_sort | Xu, Peiwen |
collection | PubMed |
description | BACKGROUND: Autosomal dominant polycystic kidney disease (ADPKD) is the most common monogenic renal disorder in humans, affecting 1 in 400 to 1000 individuals. Mutations PKD1 (which accounts for 85% of ADPKD and produces polycystin-1) and PKD2 (produces polycystin-2) are responsible for this disease. These two polycystins are critical for maintaining normal renal tubular structures during kidney development. CASE PRESENTATION: We performed genetic analysis on a family with ADPKD. DNA samples extracted from ADPKD patient blood were subject to targeted Next generation sequencing for human a panel of renal disease-related genes. A splicing mutation, c.2854-3C > G (also known as IVS11–3C > G), in the PKD1 gene was found in the 3 patients from the family, but was not found in four unaffected relatives and 100 normal control samples. Reverse transcription-PCR (RT-PCR) was performed to analyse the relative mRNA expression in the patient samples. mRNA sequencing showed that 29 bases inserted into the 3′-end of exon 11 in the PKD1 gene lead to a frameshift mutation. CONCLUSIONS: The PKD1 c.2854-3C > G mutation leads to a frameshift mutation during translation of the polycystin-1 protein, which eventually led to ADPKD in the Chinese family. |
format | Online Article Text |
id | pubmed-6234645 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-62346452018-11-23 A novel splicing mutation in the PKD1 gene causes autosomal dominant polycystic kidney disease in a Chinese family: a case report Xu, Peiwen Huang, Sexing Li, Jie Zou, Yang Gao, Ming Kang, Ranran Yan, Junhao Gao, Xuan Gao, Yuan BMC Med Genet Case Report BACKGROUND: Autosomal dominant polycystic kidney disease (ADPKD) is the most common monogenic renal disorder in humans, affecting 1 in 400 to 1000 individuals. Mutations PKD1 (which accounts for 85% of ADPKD and produces polycystin-1) and PKD2 (produces polycystin-2) are responsible for this disease. These two polycystins are critical for maintaining normal renal tubular structures during kidney development. CASE PRESENTATION: We performed genetic analysis on a family with ADPKD. DNA samples extracted from ADPKD patient blood were subject to targeted Next generation sequencing for human a panel of renal disease-related genes. A splicing mutation, c.2854-3C > G (also known as IVS11–3C > G), in the PKD1 gene was found in the 3 patients from the family, but was not found in four unaffected relatives and 100 normal control samples. Reverse transcription-PCR (RT-PCR) was performed to analyse the relative mRNA expression in the patient samples. mRNA sequencing showed that 29 bases inserted into the 3′-end of exon 11 in the PKD1 gene lead to a frameshift mutation. CONCLUSIONS: The PKD1 c.2854-3C > G mutation leads to a frameshift mutation during translation of the polycystin-1 protein, which eventually led to ADPKD in the Chinese family. BioMed Central 2018-11-13 /pmc/articles/PMC6234645/ /pubmed/30424739 http://dx.doi.org/10.1186/s12881-018-0706-6 Text en © The Author(s). 2018 Open Access This article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Case Report Xu, Peiwen Huang, Sexing Li, Jie Zou, Yang Gao, Ming Kang, Ranran Yan, Junhao Gao, Xuan Gao, Yuan A novel splicing mutation in the PKD1 gene causes autosomal dominant polycystic kidney disease in a Chinese family: a case report |
title | A novel splicing mutation in the PKD1 gene causes autosomal dominant polycystic kidney disease in a Chinese family: a case report |
title_full | A novel splicing mutation in the PKD1 gene causes autosomal dominant polycystic kidney disease in a Chinese family: a case report |
title_fullStr | A novel splicing mutation in the PKD1 gene causes autosomal dominant polycystic kidney disease in a Chinese family: a case report |
title_full_unstemmed | A novel splicing mutation in the PKD1 gene causes autosomal dominant polycystic kidney disease in a Chinese family: a case report |
title_short | A novel splicing mutation in the PKD1 gene causes autosomal dominant polycystic kidney disease in a Chinese family: a case report |
title_sort | novel splicing mutation in the pkd1 gene causes autosomal dominant polycystic kidney disease in a chinese family: a case report |
topic | Case Report |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6234645/ https://www.ncbi.nlm.nih.gov/pubmed/30424739 http://dx.doi.org/10.1186/s12881-018-0706-6 |
work_keys_str_mv | AT xupeiwen anovelsplicingmutationinthepkd1genecausesautosomaldominantpolycystickidneydiseaseinachinesefamilyacasereport AT huangsexing anovelsplicingmutationinthepkd1genecausesautosomaldominantpolycystickidneydiseaseinachinesefamilyacasereport AT lijie anovelsplicingmutationinthepkd1genecausesautosomaldominantpolycystickidneydiseaseinachinesefamilyacasereport AT zouyang anovelsplicingmutationinthepkd1genecausesautosomaldominantpolycystickidneydiseaseinachinesefamilyacasereport AT gaoming anovelsplicingmutationinthepkd1genecausesautosomaldominantpolycystickidneydiseaseinachinesefamilyacasereport AT kangranran anovelsplicingmutationinthepkd1genecausesautosomaldominantpolycystickidneydiseaseinachinesefamilyacasereport AT yanjunhao anovelsplicingmutationinthepkd1genecausesautosomaldominantpolycystickidneydiseaseinachinesefamilyacasereport AT gaoxuan anovelsplicingmutationinthepkd1genecausesautosomaldominantpolycystickidneydiseaseinachinesefamilyacasereport AT gaoyuan anovelsplicingmutationinthepkd1genecausesautosomaldominantpolycystickidneydiseaseinachinesefamilyacasereport AT xupeiwen novelsplicingmutationinthepkd1genecausesautosomaldominantpolycystickidneydiseaseinachinesefamilyacasereport AT huangsexing novelsplicingmutationinthepkd1genecausesautosomaldominantpolycystickidneydiseaseinachinesefamilyacasereport AT lijie novelsplicingmutationinthepkd1genecausesautosomaldominantpolycystickidneydiseaseinachinesefamilyacasereport AT zouyang novelsplicingmutationinthepkd1genecausesautosomaldominantpolycystickidneydiseaseinachinesefamilyacasereport AT gaoming novelsplicingmutationinthepkd1genecausesautosomaldominantpolycystickidneydiseaseinachinesefamilyacasereport AT kangranran novelsplicingmutationinthepkd1genecausesautosomaldominantpolycystickidneydiseaseinachinesefamilyacasereport AT yanjunhao novelsplicingmutationinthepkd1genecausesautosomaldominantpolycystickidneydiseaseinachinesefamilyacasereport AT gaoxuan novelsplicingmutationinthepkd1genecausesautosomaldominantpolycystickidneydiseaseinachinesefamilyacasereport AT gaoyuan novelsplicingmutationinthepkd1genecausesautosomaldominantpolycystickidneydiseaseinachinesefamilyacasereport |