Cargando…
Bioinformatics analysis to identify key genes and pathways influencing synovial inflammation in osteoarthritis
Osteoarthritis (OA) is a chronic arthropathy that occurs in the middle-aged and elderly population. The present study aimed to identify gene signature differences between synovial cells from OA synovial membrane with and without inflammation, and to explain the potential mechanisms involved. The dif...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
D.A. Spandidos
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6236257/ https://www.ncbi.nlm.nih.gov/pubmed/30365099 http://dx.doi.org/10.3892/mmr.2018.9575 |
_version_ | 1783370997634695168 |
---|---|
author | Lin, Jie Wu, Guangwen Zhao, Zhongsheng Huang, Yanfeng Chen, Jun Fu, Changlong Ye, Jinxia Liu, Xianxiang |
author_facet | Lin, Jie Wu, Guangwen Zhao, Zhongsheng Huang, Yanfeng Chen, Jun Fu, Changlong Ye, Jinxia Liu, Xianxiang |
author_sort | Lin, Jie |
collection | PubMed |
description | Osteoarthritis (OA) is a chronic arthropathy that occurs in the middle-aged and elderly population. The present study aimed to identify gene signature differences between synovial cells from OA synovial membrane with and without inflammation, and to explain the potential mechanisms involved. The differentially expressed genes (DEGs) between 12 synovial membrane with inflammation and 12 synovial membrane without inflammation from the dataset GSE46750 were identified using the Gene Expression Omnibus 2R. The DEGs were subjected to enrichment analysis, protein-protein interaction (PPI) analysis and module analysis. The analysis results were compared with text-mining results. A total of 174 DEGs were identified. Gene Ontology enrichment results demonstrated that functional molecules encoded by the DEGs primarily had extracellular location, molecular functions predominantly involving ‘chemokine activity’ and ‘cytokine activity’, and were associated with biological processes, including ‘inflammatory response’ and ‘immune response’. The Kyoto Encyclopedia of Genes and Genomes results demonstrated that DEGS may function through pathways associated with ‘rheumatoid arthritis’, ‘chemokine signaling pathway’, ‘complement and coagulation cascades’, ‘TNF signaling pathway’, ‘intestinal immune networks for IgA production’, ‘cytokine-cytokine receptor interaction’, ‘allograft rejection’, ‘Toll-like receptor signaling pathway’ and ‘antigen processing and presentation’. The top 10 hub genes [interleukin (IL)6, IL8, matrix metallopeptidase (MMP)9, colony stimulating factor 1 receptor, FOS proto-oncogene, AP1 transcription factor subunit, insulin-like growth factor 1, TYRO protein tyrosine kinase binding protein, MMP3, cluster of differentiation (CD)14 and CD163] and four gene modules were identified from the PPI network using Cytoscape. In addition, text-mining was used to identify the commonly used drugs and their targets for the treatment of OA. It was initially verified whether the results of the present study were useful for the study of OA treatment targets and pathways. The present study provided insight for the molecular mechanisms of OA synovitis. The hub genes and associated pathways derived from analysis may be targets for OA treatment. IL8 and MMP9, which were validated by text-mining, may be used as molecular targets for the OA treatment, while other hub genes require further validation. |
format | Online Article Text |
id | pubmed-6236257 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | D.A. Spandidos |
record_format | MEDLINE/PubMed |
spelling | pubmed-62362572018-11-19 Bioinformatics analysis to identify key genes and pathways influencing synovial inflammation in osteoarthritis Lin, Jie Wu, Guangwen Zhao, Zhongsheng Huang, Yanfeng Chen, Jun Fu, Changlong Ye, Jinxia Liu, Xianxiang Mol Med Rep Articles Osteoarthritis (OA) is a chronic arthropathy that occurs in the middle-aged and elderly population. The present study aimed to identify gene signature differences between synovial cells from OA synovial membrane with and without inflammation, and to explain the potential mechanisms involved. The differentially expressed genes (DEGs) between 12 synovial membrane with inflammation and 12 synovial membrane without inflammation from the dataset GSE46750 were identified using the Gene Expression Omnibus 2R. The DEGs were subjected to enrichment analysis, protein-protein interaction (PPI) analysis and module analysis. The analysis results were compared with text-mining results. A total of 174 DEGs were identified. Gene Ontology enrichment results demonstrated that functional molecules encoded by the DEGs primarily had extracellular location, molecular functions predominantly involving ‘chemokine activity’ and ‘cytokine activity’, and were associated with biological processes, including ‘inflammatory response’ and ‘immune response’. The Kyoto Encyclopedia of Genes and Genomes results demonstrated that DEGS may function through pathways associated with ‘rheumatoid arthritis’, ‘chemokine signaling pathway’, ‘complement and coagulation cascades’, ‘TNF signaling pathway’, ‘intestinal immune networks for IgA production’, ‘cytokine-cytokine receptor interaction’, ‘allograft rejection’, ‘Toll-like receptor signaling pathway’ and ‘antigen processing and presentation’. The top 10 hub genes [interleukin (IL)6, IL8, matrix metallopeptidase (MMP)9, colony stimulating factor 1 receptor, FOS proto-oncogene, AP1 transcription factor subunit, insulin-like growth factor 1, TYRO protein tyrosine kinase binding protein, MMP3, cluster of differentiation (CD)14 and CD163] and four gene modules were identified from the PPI network using Cytoscape. In addition, text-mining was used to identify the commonly used drugs and their targets for the treatment of OA. It was initially verified whether the results of the present study were useful for the study of OA treatment targets and pathways. The present study provided insight for the molecular mechanisms of OA synovitis. The hub genes and associated pathways derived from analysis may be targets for OA treatment. IL8 and MMP9, which were validated by text-mining, may be used as molecular targets for the OA treatment, while other hub genes require further validation. D.A. Spandidos 2018-12 2018-10-23 /pmc/articles/PMC6236257/ /pubmed/30365099 http://dx.doi.org/10.3892/mmr.2018.9575 Text en Copyright: © Lin et al. This is an open access article distributed under the terms of the Creative Commons Attribution-NonCommercial-NoDerivs License (https://creativecommons.org/licenses/by-nc-nd/4.0/) , which permits use and distribution in any medium, provided the original work is properly cited, the use is non-commercial and no modifications or adaptations are made. |
spellingShingle | Articles Lin, Jie Wu, Guangwen Zhao, Zhongsheng Huang, Yanfeng Chen, Jun Fu, Changlong Ye, Jinxia Liu, Xianxiang Bioinformatics analysis to identify key genes and pathways influencing synovial inflammation in osteoarthritis |
title | Bioinformatics analysis to identify key genes and pathways influencing synovial inflammation in osteoarthritis |
title_full | Bioinformatics analysis to identify key genes and pathways influencing synovial inflammation in osteoarthritis |
title_fullStr | Bioinformatics analysis to identify key genes and pathways influencing synovial inflammation in osteoarthritis |
title_full_unstemmed | Bioinformatics analysis to identify key genes and pathways influencing synovial inflammation in osteoarthritis |
title_short | Bioinformatics analysis to identify key genes and pathways influencing synovial inflammation in osteoarthritis |
title_sort | bioinformatics analysis to identify key genes and pathways influencing synovial inflammation in osteoarthritis |
topic | Articles |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6236257/ https://www.ncbi.nlm.nih.gov/pubmed/30365099 http://dx.doi.org/10.3892/mmr.2018.9575 |
work_keys_str_mv | AT linjie bioinformaticsanalysistoidentifykeygenesandpathwaysinfluencingsynovialinflammationinosteoarthritis AT wuguangwen bioinformaticsanalysistoidentifykeygenesandpathwaysinfluencingsynovialinflammationinosteoarthritis AT zhaozhongsheng bioinformaticsanalysistoidentifykeygenesandpathwaysinfluencingsynovialinflammationinosteoarthritis AT huangyanfeng bioinformaticsanalysistoidentifykeygenesandpathwaysinfluencingsynovialinflammationinosteoarthritis AT chenjun bioinformaticsanalysistoidentifykeygenesandpathwaysinfluencingsynovialinflammationinosteoarthritis AT fuchanglong bioinformaticsanalysistoidentifykeygenesandpathwaysinfluencingsynovialinflammationinosteoarthritis AT yejinxia bioinformaticsanalysistoidentifykeygenesandpathwaysinfluencingsynovialinflammationinosteoarthritis AT liuxianxiang bioinformaticsanalysistoidentifykeygenesandpathwaysinfluencingsynovialinflammationinosteoarthritis |