Cargando…

Asymptomatic myocardial ischemia forecasts adverse events in cardiovascular magnetic resonance dobutamine stress testing of high-risk middle-aged and elderly individuals

BACKGROUND: Current guidelines for assessing the risk of experiencing a hospitalized cardiovascular (CV) event discourage stress testing of asymptomatic individuals; however, these recommendations are based on evidence gathered primarily from those aged < 60 years, and do not address the possibil...

Descripción completa

Detalles Bibliográficos
Autores principales: Stacey, R. Brandon, Vera, Trinity, Morgan, Timothy M., Jordan, Jennifer H., Whitlock, Matthew C., Hall, Michael E., Vasu, Sujethra, Hamilton, Craig, Kitzman, Dalane W., Hundley, W. Gregory
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6249873/
https://www.ncbi.nlm.nih.gov/pubmed/30463565
http://dx.doi.org/10.1186/s12968-018-0492-5
_version_ 1783372838928908288
author Stacey, R. Brandon
Vera, Trinity
Morgan, Timothy M.
Jordan, Jennifer H.
Whitlock, Matthew C.
Hall, Michael E.
Vasu, Sujethra
Hamilton, Craig
Kitzman, Dalane W.
Hundley, W. Gregory
author_facet Stacey, R. Brandon
Vera, Trinity
Morgan, Timothy M.
Jordan, Jennifer H.
Whitlock, Matthew C.
Hall, Michael E.
Vasu, Sujethra
Hamilton, Craig
Kitzman, Dalane W.
Hundley, W. Gregory
author_sort Stacey, R. Brandon
collection PubMed
description BACKGROUND: Current guidelines for assessing the risk of experiencing a hospitalized cardiovascular (CV) event discourage stress testing of asymptomatic individuals; however, these recommendations are based on evidence gathered primarily from those aged < 60 years, and do not address the possibility of unrecognized “silent myocardial ischemia” in middle aged and older adults. METHODS: We performed dobutamine cardiovascular magnetic resonance (CMR) stress testing in 327 consecutively recruited participants aged > 55 years without CV-related symptoms nor known coronary artery disease, but otherwise at increased risk for a future CV event due to pre-existing hypertension or diabetes mellitus for at least 5 years. After adjusting for the demographics and CV risk factors, log-rank test and Cox proportional hazards models determined the additional predictive value of the stress test results for forecasting hospitalized CV events/survival. Either stress-induced LV wall motion abnormalities or perfusion defects were used to indicate myocardial ischemia. RESULTS: Participants averaged 68 ± 8 years in age; 39% men, 75% Caucasian. There were 38 hospitalized CV events or deaths which occurred during a mean follow-up of 58 months. Using Kaplan-Meier analyses, myocardial ischemia identified future CV events/survival (p <  0.001), but this finding was more evident in men (p <  0.001) versus women (p = 0.27). The crude hazard ratio (HR) of myocardial ischemia for CV events/survival was 3.13 (95% CI: 1.64–5.93; p < 0.001). After accounting for baseline demographics, CV risk factors, and left ventricular ejection fraction/mass, myocardial ischemia continued to be associated with CV events/survival [HR: 4.07 (95% CI: 1.95–8.73) p < 0.001]. CONCLUSIONS: Among asymptomatic middle-aged individuals with risk factors for a sentinel CV event, the presence of myocardial ischemia during dobutamine CMR testing forecasted a future hospitalized CV event or death. Further studies are needed in middle aged and older individuals to more accurately characterize the prevalence, significance, and management of asymptomatic myocardial ischemia. TRIAL REGISTRATION: (ClinicalTrials.gov identifier): NCT00542503 and was retrospectively registered on October 11th, 2007.
format Online
Article
Text
id pubmed-6249873
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-62498732018-11-26 Asymptomatic myocardial ischemia forecasts adverse events in cardiovascular magnetic resonance dobutamine stress testing of high-risk middle-aged and elderly individuals Stacey, R. Brandon Vera, Trinity Morgan, Timothy M. Jordan, Jennifer H. Whitlock, Matthew C. Hall, Michael E. Vasu, Sujethra Hamilton, Craig Kitzman, Dalane W. Hundley, W. Gregory J Cardiovasc Magn Reson Research BACKGROUND: Current guidelines for assessing the risk of experiencing a hospitalized cardiovascular (CV) event discourage stress testing of asymptomatic individuals; however, these recommendations are based on evidence gathered primarily from those aged < 60 years, and do not address the possibility of unrecognized “silent myocardial ischemia” in middle aged and older adults. METHODS: We performed dobutamine cardiovascular magnetic resonance (CMR) stress testing in 327 consecutively recruited participants aged > 55 years without CV-related symptoms nor known coronary artery disease, but otherwise at increased risk for a future CV event due to pre-existing hypertension or diabetes mellitus for at least 5 years. After adjusting for the demographics and CV risk factors, log-rank test and Cox proportional hazards models determined the additional predictive value of the stress test results for forecasting hospitalized CV events/survival. Either stress-induced LV wall motion abnormalities or perfusion defects were used to indicate myocardial ischemia. RESULTS: Participants averaged 68 ± 8 years in age; 39% men, 75% Caucasian. There were 38 hospitalized CV events or deaths which occurred during a mean follow-up of 58 months. Using Kaplan-Meier analyses, myocardial ischemia identified future CV events/survival (p <  0.001), but this finding was more evident in men (p <  0.001) versus women (p = 0.27). The crude hazard ratio (HR) of myocardial ischemia for CV events/survival was 3.13 (95% CI: 1.64–5.93; p < 0.001). After accounting for baseline demographics, CV risk factors, and left ventricular ejection fraction/mass, myocardial ischemia continued to be associated with CV events/survival [HR: 4.07 (95% CI: 1.95–8.73) p < 0.001]. CONCLUSIONS: Among asymptomatic middle-aged individuals with risk factors for a sentinel CV event, the presence of myocardial ischemia during dobutamine CMR testing forecasted a future hospitalized CV event or death. Further studies are needed in middle aged and older individuals to more accurately characterize the prevalence, significance, and management of asymptomatic myocardial ischemia. TRIAL REGISTRATION: (ClinicalTrials.gov identifier): NCT00542503 and was retrospectively registered on October 11th, 2007. BioMed Central 2018-11-22 /pmc/articles/PMC6249873/ /pubmed/30463565 http://dx.doi.org/10.1186/s12968-018-0492-5 Text en © The Author(s). 2018 Open Access This article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research
Stacey, R. Brandon
Vera, Trinity
Morgan, Timothy M.
Jordan, Jennifer H.
Whitlock, Matthew C.
Hall, Michael E.
Vasu, Sujethra
Hamilton, Craig
Kitzman, Dalane W.
Hundley, W. Gregory
Asymptomatic myocardial ischemia forecasts adverse events in cardiovascular magnetic resonance dobutamine stress testing of high-risk middle-aged and elderly individuals
title Asymptomatic myocardial ischemia forecasts adverse events in cardiovascular magnetic resonance dobutamine stress testing of high-risk middle-aged and elderly individuals
title_full Asymptomatic myocardial ischemia forecasts adverse events in cardiovascular magnetic resonance dobutamine stress testing of high-risk middle-aged and elderly individuals
title_fullStr Asymptomatic myocardial ischemia forecasts adverse events in cardiovascular magnetic resonance dobutamine stress testing of high-risk middle-aged and elderly individuals
title_full_unstemmed Asymptomatic myocardial ischemia forecasts adverse events in cardiovascular magnetic resonance dobutamine stress testing of high-risk middle-aged and elderly individuals
title_short Asymptomatic myocardial ischemia forecasts adverse events in cardiovascular magnetic resonance dobutamine stress testing of high-risk middle-aged and elderly individuals
title_sort asymptomatic myocardial ischemia forecasts adverse events in cardiovascular magnetic resonance dobutamine stress testing of high-risk middle-aged and elderly individuals
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6249873/
https://www.ncbi.nlm.nih.gov/pubmed/30463565
http://dx.doi.org/10.1186/s12968-018-0492-5
work_keys_str_mv AT staceyrbrandon asymptomaticmyocardialischemiaforecastsadverseeventsincardiovascularmagneticresonancedobutaminestresstestingofhighriskmiddleagedandelderlyindividuals
AT veratrinity asymptomaticmyocardialischemiaforecastsadverseeventsincardiovascularmagneticresonancedobutaminestresstestingofhighriskmiddleagedandelderlyindividuals
AT morgantimothym asymptomaticmyocardialischemiaforecastsadverseeventsincardiovascularmagneticresonancedobutaminestresstestingofhighriskmiddleagedandelderlyindividuals
AT jordanjenniferh asymptomaticmyocardialischemiaforecastsadverseeventsincardiovascularmagneticresonancedobutaminestresstestingofhighriskmiddleagedandelderlyindividuals
AT whitlockmatthewc asymptomaticmyocardialischemiaforecastsadverseeventsincardiovascularmagneticresonancedobutaminestresstestingofhighriskmiddleagedandelderlyindividuals
AT hallmichaele asymptomaticmyocardialischemiaforecastsadverseeventsincardiovascularmagneticresonancedobutaminestresstestingofhighriskmiddleagedandelderlyindividuals
AT vasusujethra asymptomaticmyocardialischemiaforecastsadverseeventsincardiovascularmagneticresonancedobutaminestresstestingofhighriskmiddleagedandelderlyindividuals
AT hamiltoncraig asymptomaticmyocardialischemiaforecastsadverseeventsincardiovascularmagneticresonancedobutaminestresstestingofhighriskmiddleagedandelderlyindividuals
AT kitzmandalanew asymptomaticmyocardialischemiaforecastsadverseeventsincardiovascularmagneticresonancedobutaminestresstestingofhighriskmiddleagedandelderlyindividuals
AT hundleywgregory asymptomaticmyocardialischemiaforecastsadverseeventsincardiovascularmagneticresonancedobutaminestresstestingofhighriskmiddleagedandelderlyindividuals