Cargando…

Prognostic significance of mammary Paget’s disease in Chinese women: a 10-year, population-based, matched cohort study

PURPOSE: To explore the prognostic significance of mammary Paget’s disease (PD) in breast cancer (BC) patients and to investigate the association between clinical manifestation and outcome in invasive ductal carcinoma patients with PD (PD-IDC). PATIENTS AND METHODS: Eighty-five patients diagnosed wi...

Descripción completa

Detalles Bibliográficos
Autores principales: Zhou, Huanhuan, Lu, Kongbeng, Zheng, Lei, Guo, Liwei, Gao, Yun, Miao, Xianyuan, Chen, Zhanhong, Wang, Xiaojia
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Dove Medical Press 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6260180/
https://www.ncbi.nlm.nih.gov/pubmed/30538501
http://dx.doi.org/10.2147/OTT.S171710
_version_ 1783374756989370368
author Zhou, Huanhuan
Lu, Kongbeng
Zheng, Lei
Guo, Liwei
Gao, Yun
Miao, Xianyuan
Chen, Zhanhong
Wang, Xiaojia
author_facet Zhou, Huanhuan
Lu, Kongbeng
Zheng, Lei
Guo, Liwei
Gao, Yun
Miao, Xianyuan
Chen, Zhanhong
Wang, Xiaojia
author_sort Zhou, Huanhuan
collection PubMed
description PURPOSE: To explore the prognostic significance of mammary Paget’s disease (PD) in breast cancer (BC) patients and to investigate the association between clinical manifestation and outcome in invasive ductal carcinoma patients with PD (PD-IDC). PATIENTS AND METHODS: Eighty-five patients diagnosed with mammary PD with underlying BC from 2006 to 2012 at Zhejiang Cancer Hospital were recruited. A matched group comprised 85 patients diagnosed with BC without PD. Patients were matched according to four variables: stage (0–IV), age at diagnosis (within 5 years), histologic subtype, and the year of surgery. The 74 patients diagnosed with PD-IDC were divided into three groups based on their clinical presentation. RESULTS: Compared with the matched group, the PD group had more HER2 positivity (P<0.01) and hormone receptor negativity (P<0.01), and a worse outcome (Kaplan–Meier analysis, P<0.001 for disease-free survival and P=0.002 for overall survival). Multivariate Cox regression analyses showed that PD was an independent prognostic predictor for BC patients with PD. In addition, the 22 PD-IDC patients who presented with skin lesions in the nipple/areola and a mass in the breast or axilla had a higher risk of disease relapse than patients who presented with a mass in the breast without skin lesions or patients who presented with skin changes without a palpable mass (adjusted hazards ratio, 0.24; 95% CI, 0.08–0.73; P=0.012 and adjusted hazard ratio, 0.30; 95% CI, 0.06–1.40; P=0.124, respectively). CONCLUSION: PD is an independent prognostic indicator of outcome in BC patients with PD. Furthermore, the primary symptoms at presentation may be an available indicator of prognosis in PD-IDC.
format Online
Article
Text
id pubmed-6260180
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher Dove Medical Press
record_format MEDLINE/PubMed
spelling pubmed-62601802018-12-11 Prognostic significance of mammary Paget’s disease in Chinese women: a 10-year, population-based, matched cohort study Zhou, Huanhuan Lu, Kongbeng Zheng, Lei Guo, Liwei Gao, Yun Miao, Xianyuan Chen, Zhanhong Wang, Xiaojia Onco Targets Ther Original Research PURPOSE: To explore the prognostic significance of mammary Paget’s disease (PD) in breast cancer (BC) patients and to investigate the association between clinical manifestation and outcome in invasive ductal carcinoma patients with PD (PD-IDC). PATIENTS AND METHODS: Eighty-five patients diagnosed with mammary PD with underlying BC from 2006 to 2012 at Zhejiang Cancer Hospital were recruited. A matched group comprised 85 patients diagnosed with BC without PD. Patients were matched according to four variables: stage (0–IV), age at diagnosis (within 5 years), histologic subtype, and the year of surgery. The 74 patients diagnosed with PD-IDC were divided into three groups based on their clinical presentation. RESULTS: Compared with the matched group, the PD group had more HER2 positivity (P<0.01) and hormone receptor negativity (P<0.01), and a worse outcome (Kaplan–Meier analysis, P<0.001 for disease-free survival and P=0.002 for overall survival). Multivariate Cox regression analyses showed that PD was an independent prognostic predictor for BC patients with PD. In addition, the 22 PD-IDC patients who presented with skin lesions in the nipple/areola and a mass in the breast or axilla had a higher risk of disease relapse than patients who presented with a mass in the breast without skin lesions or patients who presented with skin changes without a palpable mass (adjusted hazards ratio, 0.24; 95% CI, 0.08–0.73; P=0.012 and adjusted hazard ratio, 0.30; 95% CI, 0.06–1.40; P=0.124, respectively). CONCLUSION: PD is an independent prognostic indicator of outcome in BC patients with PD. Furthermore, the primary symptoms at presentation may be an available indicator of prognosis in PD-IDC. Dove Medical Press 2018-11-23 /pmc/articles/PMC6260180/ /pubmed/30538501 http://dx.doi.org/10.2147/OTT.S171710 Text en © 2018 Zhou et al. This work is published and licensed by Dove Medical Press Limited The full terms of this license are available at https://www.dovepress.com/terms.php and incorporate the Creative Commons Attribution – Non Commercial (unported, v3.0) License (http://creativecommons.org/licenses/by-nc/3.0/). By accessing the work you hereby accept the Terms. Non-commercial uses of the work are permitted without any further permission from Dove Medical Press Limited, provided the work is properly attributed.
spellingShingle Original Research
Zhou, Huanhuan
Lu, Kongbeng
Zheng, Lei
Guo, Liwei
Gao, Yun
Miao, Xianyuan
Chen, Zhanhong
Wang, Xiaojia
Prognostic significance of mammary Paget’s disease in Chinese women: a 10-year, population-based, matched cohort study
title Prognostic significance of mammary Paget’s disease in Chinese women: a 10-year, population-based, matched cohort study
title_full Prognostic significance of mammary Paget’s disease in Chinese women: a 10-year, population-based, matched cohort study
title_fullStr Prognostic significance of mammary Paget’s disease in Chinese women: a 10-year, population-based, matched cohort study
title_full_unstemmed Prognostic significance of mammary Paget’s disease in Chinese women: a 10-year, population-based, matched cohort study
title_short Prognostic significance of mammary Paget’s disease in Chinese women: a 10-year, population-based, matched cohort study
title_sort prognostic significance of mammary paget’s disease in chinese women: a 10-year, population-based, matched cohort study
topic Original Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6260180/
https://www.ncbi.nlm.nih.gov/pubmed/30538501
http://dx.doi.org/10.2147/OTT.S171710
work_keys_str_mv AT zhouhuanhuan prognosticsignificanceofmammarypagetsdiseaseinchinesewomena10yearpopulationbasedmatchedcohortstudy
AT lukongbeng prognosticsignificanceofmammarypagetsdiseaseinchinesewomena10yearpopulationbasedmatchedcohortstudy
AT zhenglei prognosticsignificanceofmammarypagetsdiseaseinchinesewomena10yearpopulationbasedmatchedcohortstudy
AT guoliwei prognosticsignificanceofmammarypagetsdiseaseinchinesewomena10yearpopulationbasedmatchedcohortstudy
AT gaoyun prognosticsignificanceofmammarypagetsdiseaseinchinesewomena10yearpopulationbasedmatchedcohortstudy
AT miaoxianyuan prognosticsignificanceofmammarypagetsdiseaseinchinesewomena10yearpopulationbasedmatchedcohortstudy
AT chenzhanhong prognosticsignificanceofmammarypagetsdiseaseinchinesewomena10yearpopulationbasedmatchedcohortstudy
AT wangxiaojia prognosticsignificanceofmammarypagetsdiseaseinchinesewomena10yearpopulationbasedmatchedcohortstudy