Cargando…
Anti-Hepatitis B Virus Activity of Chickweed [Stellaria media (L.) Vill.] Extracts in HepG2.2.15 Cells
Stellaria media (Linn.) Villars is a traditional Chinese medicine that has been used for over 200 years, mainly for the treatment of dermatitis and other skin diseases. It has also been used as an anti-viral agent. All the fresh chickweed juice samples used in this study were prepared using macropor...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2012
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6268626/ https://www.ncbi.nlm.nih.gov/pubmed/22810196 http://dx.doi.org/10.3390/molecules17078633 |
_version_ | 1783376329733832704 |
---|---|
author | Ma, Lihua Song, Jie Shi, Yaqin Wang, Changmei Chen, Bin Xie, Donghao Jia, Xiaobin |
author_facet | Ma, Lihua Song, Jie Shi, Yaqin Wang, Changmei Chen, Bin Xie, Donghao Jia, Xiaobin |
author_sort | Ma, Lihua |
collection | PubMed |
description | Stellaria media (Linn.) Villars is a traditional Chinese medicine that has been used for over 200 years, mainly for the treatment of dermatitis and other skin diseases. It has also been used as an anti-viral agent. All the fresh chickweed juice samples used in this study were prepared using macroporous resin and ultrafiltration technology. The anti-hepatitis B virus (HBV) activity of S. media was evaluated in vitro using the human HBV-transfected liver cell line HepG2.2.15. The concentrations of hepatitis B surface antigen (HBsAg) and hepatitis B e antigen (HBeAg) in HepG2.2.15 cell culture medium were determined by enzyme-linked immunosorbent assay (ELISA) after S. media-n (SM-n) treatment for 6 or 9 days. HBV DNA was quantified using transcription-mediated amplification and real-time polymerase chain reaction. In HepG2.2.15 cells, 30 μg/mL SM-3 effectively suppressed the secretion of HBsAg and HBeAg with inhibition rates of 27.92% and 25.35% after 6 days of treatment, respectively. Consistent with the reduction in HBV antigens, SM-3 also reduced the level of HBV DNA in a dose-dependent manner. The characterization and quantitation of the chemical composition of SM-3 showed the presence of flavonoid C-glycosides, polysaccharides, and protein, which exhibited diverse antiviral activities. In conclusion, our results demonstrate that SM-3 possesses potential anti-HBV activity in vitro. This is the first report demonstrating the anti-HBV effects of S. media, which is currently under early development as a potential anti-HBV drug candidate. |
format | Online Article Text |
id | pubmed-6268626 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2012 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-62686262018-12-12 Anti-Hepatitis B Virus Activity of Chickweed [Stellaria media (L.) Vill.] Extracts in HepG2.2.15 Cells Ma, Lihua Song, Jie Shi, Yaqin Wang, Changmei Chen, Bin Xie, Donghao Jia, Xiaobin Molecules Article Stellaria media (Linn.) Villars is a traditional Chinese medicine that has been used for over 200 years, mainly for the treatment of dermatitis and other skin diseases. It has also been used as an anti-viral agent. All the fresh chickweed juice samples used in this study were prepared using macroporous resin and ultrafiltration technology. The anti-hepatitis B virus (HBV) activity of S. media was evaluated in vitro using the human HBV-transfected liver cell line HepG2.2.15. The concentrations of hepatitis B surface antigen (HBsAg) and hepatitis B e antigen (HBeAg) in HepG2.2.15 cell culture medium were determined by enzyme-linked immunosorbent assay (ELISA) after S. media-n (SM-n) treatment for 6 or 9 days. HBV DNA was quantified using transcription-mediated amplification and real-time polymerase chain reaction. In HepG2.2.15 cells, 30 μg/mL SM-3 effectively suppressed the secretion of HBsAg and HBeAg with inhibition rates of 27.92% and 25.35% after 6 days of treatment, respectively. Consistent with the reduction in HBV antigens, SM-3 also reduced the level of HBV DNA in a dose-dependent manner. The characterization and quantitation of the chemical composition of SM-3 showed the presence of flavonoid C-glycosides, polysaccharides, and protein, which exhibited diverse antiviral activities. In conclusion, our results demonstrate that SM-3 possesses potential anti-HBV activity in vitro. This is the first report demonstrating the anti-HBV effects of S. media, which is currently under early development as a potential anti-HBV drug candidate. MDPI 2012-07-18 /pmc/articles/PMC6268626/ /pubmed/22810196 http://dx.doi.org/10.3390/molecules17078633 Text en © 2012 by the authors; licensee MDPI, Basel, Switzerland. http://creativecommons.org/licenses/by/3.0/ This article is an open-access article distributed under the terms and conditions of the Creative Commons Attribution license (http://creativecommons.org/licenses/by/3.0/). |
spellingShingle | Article Ma, Lihua Song, Jie Shi, Yaqin Wang, Changmei Chen, Bin Xie, Donghao Jia, Xiaobin Anti-Hepatitis B Virus Activity of Chickweed [Stellaria media (L.) Vill.] Extracts in HepG2.2.15 Cells |
title | Anti-Hepatitis B Virus Activity of Chickweed [Stellaria media (L.) Vill.] Extracts in HepG2.2.15 Cells |
title_full | Anti-Hepatitis B Virus Activity of Chickweed [Stellaria media (L.) Vill.] Extracts in HepG2.2.15 Cells |
title_fullStr | Anti-Hepatitis B Virus Activity of Chickweed [Stellaria media (L.) Vill.] Extracts in HepG2.2.15 Cells |
title_full_unstemmed | Anti-Hepatitis B Virus Activity of Chickweed [Stellaria media (L.) Vill.] Extracts in HepG2.2.15 Cells |
title_short | Anti-Hepatitis B Virus Activity of Chickweed [Stellaria media (L.) Vill.] Extracts in HepG2.2.15 Cells |
title_sort | anti-hepatitis b virus activity of chickweed [stellaria media (l.) vill.] extracts in hepg2.2.15 cells |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6268626/ https://www.ncbi.nlm.nih.gov/pubmed/22810196 http://dx.doi.org/10.3390/molecules17078633 |
work_keys_str_mv | AT malihua antihepatitisbvirusactivityofchickweedstellariamedialvillextractsinhepg2215cells AT songjie antihepatitisbvirusactivityofchickweedstellariamedialvillextractsinhepg2215cells AT shiyaqin antihepatitisbvirusactivityofchickweedstellariamedialvillextractsinhepg2215cells AT wangchangmei antihepatitisbvirusactivityofchickweedstellariamedialvillextractsinhepg2215cells AT chenbin antihepatitisbvirusactivityofchickweedstellariamedialvillextractsinhepg2215cells AT xiedonghao antihepatitisbvirusactivityofchickweedstellariamedialvillextractsinhepg2215cells AT jiaxiaobin antihepatitisbvirusactivityofchickweedstellariamedialvillextractsinhepg2215cells |