Cargando…
The Protection of Selenium against Cadmium-Induced Cytotoxicity via the Heat Shock Protein Pathway in Chicken Splenic Lymphocytes
Cadmium (Cd) is a heavy metal that poses a hazard to animal health due to its toxicity. Selenium (Se) is an important nutritional trace element. However, the potential protective effects of Se against Cd-induced toxicity remain to be elucidated. To investigate the cytotoxicity of Cd on bird immunocy...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2012
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6268861/ https://www.ncbi.nlm.nih.gov/pubmed/23222903 http://dx.doi.org/10.3390/molecules171214565 |
_version_ | 1783376383538364416 |
---|---|
author | Chen, Xi Zhu, Yi-Hao Cheng, Xin-Yue Zhang, Zi-Wei Xu, Shi-Wen |
author_facet | Chen, Xi Zhu, Yi-Hao Cheng, Xin-Yue Zhang, Zi-Wei Xu, Shi-Wen |
author_sort | Chen, Xi |
collection | PubMed |
description | Cadmium (Cd) is a heavy metal that poses a hazard to animal health due to its toxicity. Selenium (Se) is an important nutritional trace element. However, the potential protective effects of Se against Cd-induced toxicity remain to be elucidated. To investigate the cytotoxicity of Cd on bird immunocytes in vitro and the protective effects of Se against exposure to Cd, chicken splenic lymphocytes received Cd (10(−6) mol/L), Se (10(−7) mol/L), and the mixture of 10(−7) mol/L Se and 10(−6) mol/L Cd and were incubated for 12 h, 24 h, 36 h, 48 h, respectively. The transcription of heat shock protein (HSP) 27, HSP40, HSP60, HSP70 and HSP90 mRNA was tested by fluorescence quantitative PCR. The results showed that the mRNA expression of HSPs exposed to 10(−6) mol/L Cd showed a sustained decrease at 12–48 h exposure. A statistically significant increase in the mRNA expression of HSPs in the case of Se group was observed, as compared to the control group of chicken splenic lymphocytes. Concomitantly, treatment of chicken splenic lymphocytes with Se in combination with Cd enhanced the mRNA expression of HSPs which were reduced by Cd treatment. This indicated that the protective effect of Se against the toxicity of Cd might, at least partially, be attributed to stimulation of the level of HSPs. |
format | Online Article Text |
id | pubmed-6268861 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2012 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-62688612018-12-14 The Protection of Selenium against Cadmium-Induced Cytotoxicity via the Heat Shock Protein Pathway in Chicken Splenic Lymphocytes Chen, Xi Zhu, Yi-Hao Cheng, Xin-Yue Zhang, Zi-Wei Xu, Shi-Wen Molecules Article Cadmium (Cd) is a heavy metal that poses a hazard to animal health due to its toxicity. Selenium (Se) is an important nutritional trace element. However, the potential protective effects of Se against Cd-induced toxicity remain to be elucidated. To investigate the cytotoxicity of Cd on bird immunocytes in vitro and the protective effects of Se against exposure to Cd, chicken splenic lymphocytes received Cd (10(−6) mol/L), Se (10(−7) mol/L), and the mixture of 10(−7) mol/L Se and 10(−6) mol/L Cd and were incubated for 12 h, 24 h, 36 h, 48 h, respectively. The transcription of heat shock protein (HSP) 27, HSP40, HSP60, HSP70 and HSP90 mRNA was tested by fluorescence quantitative PCR. The results showed that the mRNA expression of HSPs exposed to 10(−6) mol/L Cd showed a sustained decrease at 12–48 h exposure. A statistically significant increase in the mRNA expression of HSPs in the case of Se group was observed, as compared to the control group of chicken splenic lymphocytes. Concomitantly, treatment of chicken splenic lymphocytes with Se in combination with Cd enhanced the mRNA expression of HSPs which were reduced by Cd treatment. This indicated that the protective effect of Se against the toxicity of Cd might, at least partially, be attributed to stimulation of the level of HSPs. MDPI 2012-12-07 /pmc/articles/PMC6268861/ /pubmed/23222903 http://dx.doi.org/10.3390/molecules171214565 Text en © 2012 by the authors; licensee MDPI, Basel, Switzerland. http://creativecommons.org/licenses/by/3.0/ This article is an open-access article distributed under the terms and conditions of the Creative Commons Attribution license (http://creativecommons.org/licenses/by/3.0/). |
spellingShingle | Article Chen, Xi Zhu, Yi-Hao Cheng, Xin-Yue Zhang, Zi-Wei Xu, Shi-Wen The Protection of Selenium against Cadmium-Induced Cytotoxicity via the Heat Shock Protein Pathway in Chicken Splenic Lymphocytes |
title | The Protection of Selenium against Cadmium-Induced Cytotoxicity via the Heat Shock Protein Pathway in Chicken Splenic Lymphocytes |
title_full | The Protection of Selenium against Cadmium-Induced Cytotoxicity via the Heat Shock Protein Pathway in Chicken Splenic Lymphocytes |
title_fullStr | The Protection of Selenium against Cadmium-Induced Cytotoxicity via the Heat Shock Protein Pathway in Chicken Splenic Lymphocytes |
title_full_unstemmed | The Protection of Selenium against Cadmium-Induced Cytotoxicity via the Heat Shock Protein Pathway in Chicken Splenic Lymphocytes |
title_short | The Protection of Selenium against Cadmium-Induced Cytotoxicity via the Heat Shock Protein Pathway in Chicken Splenic Lymphocytes |
title_sort | protection of selenium against cadmium-induced cytotoxicity via the heat shock protein pathway in chicken splenic lymphocytes |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6268861/ https://www.ncbi.nlm.nih.gov/pubmed/23222903 http://dx.doi.org/10.3390/molecules171214565 |
work_keys_str_mv | AT chenxi theprotectionofseleniumagainstcadmiuminducedcytotoxicityviatheheatshockproteinpathwayinchickenspleniclymphocytes AT zhuyihao theprotectionofseleniumagainstcadmiuminducedcytotoxicityviatheheatshockproteinpathwayinchickenspleniclymphocytes AT chengxinyue theprotectionofseleniumagainstcadmiuminducedcytotoxicityviatheheatshockproteinpathwayinchickenspleniclymphocytes AT zhangziwei theprotectionofseleniumagainstcadmiuminducedcytotoxicityviatheheatshockproteinpathwayinchickenspleniclymphocytes AT xushiwen theprotectionofseleniumagainstcadmiuminducedcytotoxicityviatheheatshockproteinpathwayinchickenspleniclymphocytes AT chenxi protectionofseleniumagainstcadmiuminducedcytotoxicityviatheheatshockproteinpathwayinchickenspleniclymphocytes AT zhuyihao protectionofseleniumagainstcadmiuminducedcytotoxicityviatheheatshockproteinpathwayinchickenspleniclymphocytes AT chengxinyue protectionofseleniumagainstcadmiuminducedcytotoxicityviatheheatshockproteinpathwayinchickenspleniclymphocytes AT zhangziwei protectionofseleniumagainstcadmiuminducedcytotoxicityviatheheatshockproteinpathwayinchickenspleniclymphocytes AT xushiwen protectionofseleniumagainstcadmiuminducedcytotoxicityviatheheatshockproteinpathwayinchickenspleniclymphocytes |