Cargando…

The Protection of Selenium against Cadmium-Induced Cytotoxicity via the Heat Shock Protein Pathway in Chicken Splenic Lymphocytes

Cadmium (Cd) is a heavy metal that poses a hazard to animal health due to its toxicity. Selenium (Se) is an important nutritional trace element. However, the potential protective effects of Se against Cd-induced toxicity remain to be elucidated. To investigate the cytotoxicity of Cd on bird immunocy...

Descripción completa

Detalles Bibliográficos
Autores principales: Chen, Xi, Zhu, Yi-Hao, Cheng, Xin-Yue, Zhang, Zi-Wei, Xu, Shi-Wen
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2012
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6268861/
https://www.ncbi.nlm.nih.gov/pubmed/23222903
http://dx.doi.org/10.3390/molecules171214565
_version_ 1783376383538364416
author Chen, Xi
Zhu, Yi-Hao
Cheng, Xin-Yue
Zhang, Zi-Wei
Xu, Shi-Wen
author_facet Chen, Xi
Zhu, Yi-Hao
Cheng, Xin-Yue
Zhang, Zi-Wei
Xu, Shi-Wen
author_sort Chen, Xi
collection PubMed
description Cadmium (Cd) is a heavy metal that poses a hazard to animal health due to its toxicity. Selenium (Se) is an important nutritional trace element. However, the potential protective effects of Se against Cd-induced toxicity remain to be elucidated. To investigate the cytotoxicity of Cd on bird immunocytes in vitro and the protective effects of Se against exposure to Cd, chicken splenic lymphocytes received Cd (10(−6) mol/L), Se (10(−7) mol/L), and the mixture of 10(−7) mol/L Se and 10(−6) mol/L Cd and were incubated for 12 h, 24 h, 36 h, 48 h, respectively. The transcription of heat shock protein (HSP) 27, HSP40, HSP60, HSP70 and HSP90 mRNA was tested by fluorescence quantitative PCR. The results showed that the mRNA expression of HSPs exposed to 10(−6) mol/L Cd showed a sustained decrease at 12–48 h exposure. A statistically significant increase in the mRNA expression of HSPs in the case of Se group was observed, as compared to the control group of chicken splenic lymphocytes. Concomitantly, treatment of chicken splenic lymphocytes with Se in combination with Cd enhanced the mRNA expression of HSPs which were reduced by Cd treatment. This indicated that the protective effect of Se against the toxicity of Cd might, at least partially, be attributed to stimulation of the level of HSPs.
format Online
Article
Text
id pubmed-6268861
institution National Center for Biotechnology Information
language English
publishDate 2012
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-62688612018-12-14 The Protection of Selenium against Cadmium-Induced Cytotoxicity via the Heat Shock Protein Pathway in Chicken Splenic Lymphocytes Chen, Xi Zhu, Yi-Hao Cheng, Xin-Yue Zhang, Zi-Wei Xu, Shi-Wen Molecules Article Cadmium (Cd) is a heavy metal that poses a hazard to animal health due to its toxicity. Selenium (Se) is an important nutritional trace element. However, the potential protective effects of Se against Cd-induced toxicity remain to be elucidated. To investigate the cytotoxicity of Cd on bird immunocytes in vitro and the protective effects of Se against exposure to Cd, chicken splenic lymphocytes received Cd (10(−6) mol/L), Se (10(−7) mol/L), and the mixture of 10(−7) mol/L Se and 10(−6) mol/L Cd and were incubated for 12 h, 24 h, 36 h, 48 h, respectively. The transcription of heat shock protein (HSP) 27, HSP40, HSP60, HSP70 and HSP90 mRNA was tested by fluorescence quantitative PCR. The results showed that the mRNA expression of HSPs exposed to 10(−6) mol/L Cd showed a sustained decrease at 12–48 h exposure. A statistically significant increase in the mRNA expression of HSPs in the case of Se group was observed, as compared to the control group of chicken splenic lymphocytes. Concomitantly, treatment of chicken splenic lymphocytes with Se in combination with Cd enhanced the mRNA expression of HSPs which were reduced by Cd treatment. This indicated that the protective effect of Se against the toxicity of Cd might, at least partially, be attributed to stimulation of the level of HSPs. MDPI 2012-12-07 /pmc/articles/PMC6268861/ /pubmed/23222903 http://dx.doi.org/10.3390/molecules171214565 Text en © 2012 by the authors; licensee MDPI, Basel, Switzerland. http://creativecommons.org/licenses/by/3.0/ This article is an open-access article distributed under the terms and conditions of the Creative Commons Attribution license (http://creativecommons.org/licenses/by/3.0/).
spellingShingle Article
Chen, Xi
Zhu, Yi-Hao
Cheng, Xin-Yue
Zhang, Zi-Wei
Xu, Shi-Wen
The Protection of Selenium against Cadmium-Induced Cytotoxicity via the Heat Shock Protein Pathway in Chicken Splenic Lymphocytes
title The Protection of Selenium against Cadmium-Induced Cytotoxicity via the Heat Shock Protein Pathway in Chicken Splenic Lymphocytes
title_full The Protection of Selenium against Cadmium-Induced Cytotoxicity via the Heat Shock Protein Pathway in Chicken Splenic Lymphocytes
title_fullStr The Protection of Selenium against Cadmium-Induced Cytotoxicity via the Heat Shock Protein Pathway in Chicken Splenic Lymphocytes
title_full_unstemmed The Protection of Selenium against Cadmium-Induced Cytotoxicity via the Heat Shock Protein Pathway in Chicken Splenic Lymphocytes
title_short The Protection of Selenium against Cadmium-Induced Cytotoxicity via the Heat Shock Protein Pathway in Chicken Splenic Lymphocytes
title_sort protection of selenium against cadmium-induced cytotoxicity via the heat shock protein pathway in chicken splenic lymphocytes
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6268861/
https://www.ncbi.nlm.nih.gov/pubmed/23222903
http://dx.doi.org/10.3390/molecules171214565
work_keys_str_mv AT chenxi theprotectionofseleniumagainstcadmiuminducedcytotoxicityviatheheatshockproteinpathwayinchickenspleniclymphocytes
AT zhuyihao theprotectionofseleniumagainstcadmiuminducedcytotoxicityviatheheatshockproteinpathwayinchickenspleniclymphocytes
AT chengxinyue theprotectionofseleniumagainstcadmiuminducedcytotoxicityviatheheatshockproteinpathwayinchickenspleniclymphocytes
AT zhangziwei theprotectionofseleniumagainstcadmiuminducedcytotoxicityviatheheatshockproteinpathwayinchickenspleniclymphocytes
AT xushiwen theprotectionofseleniumagainstcadmiuminducedcytotoxicityviatheheatshockproteinpathwayinchickenspleniclymphocytes
AT chenxi protectionofseleniumagainstcadmiuminducedcytotoxicityviatheheatshockproteinpathwayinchickenspleniclymphocytes
AT zhuyihao protectionofseleniumagainstcadmiuminducedcytotoxicityviatheheatshockproteinpathwayinchickenspleniclymphocytes
AT chengxinyue protectionofseleniumagainstcadmiuminducedcytotoxicityviatheheatshockproteinpathwayinchickenspleniclymphocytes
AT zhangziwei protectionofseleniumagainstcadmiuminducedcytotoxicityviatheheatshockproteinpathwayinchickenspleniclymphocytes
AT xushiwen protectionofseleniumagainstcadmiuminducedcytotoxicityviatheheatshockproteinpathwayinchickenspleniclymphocytes