Cargando…
GSK3β Regulates Milk Synthesis in and Proliferation of Dairy Cow Mammary Epithelial Cells via the mTOR/S6K1 Signaling Pathway
Glycogen synthase kinase 3 (GSK3) is a serine/threonine kinase, whose activity is inhibited by AKT phosphorylation. This inhibitory phosphorylation of GSK3β can in turn play a regulatory role through phosphorylation of several proteins (such as mTOR, elF2B) to promote protein synthesis. mTOR is a ke...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2014
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6271057/ https://www.ncbi.nlm.nih.gov/pubmed/24995926 http://dx.doi.org/10.3390/molecules19079435 |
_version_ | 1783376840990130176 |
---|---|
author | Zhang, Xia Zhao, Feng Si, Yu Huang, Yuling Yu, Cuiping Luo, Chaochao Zhang, Na Li, Qingzhang Gao, Xuejun |
author_facet | Zhang, Xia Zhao, Feng Si, Yu Huang, Yuling Yu, Cuiping Luo, Chaochao Zhang, Na Li, Qingzhang Gao, Xuejun |
author_sort | Zhang, Xia |
collection | PubMed |
description | Glycogen synthase kinase 3 (GSK3) is a serine/threonine kinase, whose activity is inhibited by AKT phosphorylation. This inhibitory phosphorylation of GSK3β can in turn play a regulatory role through phosphorylation of several proteins (such as mTOR, elF2B) to promote protein synthesis. mTOR is a key regulator in protein synthesis and cell proliferation, and recent studies have shown that both GSK3β and mTORC1 can regulate SREBP1 to promote fat synthesis. Thus far, however, the cross talk between GSK3β and the mTOR pathway in the regulation of milk synthesis and associated cell proliferation is not well understood. In this study the interrelationship between GSK3β and the mTOR/S6K1 signaling pathway leading to milk synthesis and proliferation of dairy cow mammary epithelial cells (DCMECs) was analyzed using techniques including GSK3β overexpression by transfection, GSK3β inhibition, mTOR inhibition and methionine stimulation. The analyses revealed that GSK3β represses the mTOR/S6K1 pathway leading to milk synthesis and cell proliferation of DCMECs, whereas GSK3β phosphorylation enhances this pathway. Conversely, the activated mTOR/S6K1 signaling pathway downregulates GSK3β expression but enhances GSK3β phosphorylation to increase milk synthesis and cell proliferation, whereas inhibition of mTOR leads to upregulation of GSK3β and repression of GSK3β phosphorylation, which in turn decreases milk synthesis, and cell proliferation. These findings indicate that GSK3β and phosphorylated GSK3β regulate milk synthesis and proliferation of DCMECs via the mTOR/S6K1 signaling pathway. These findings provide new insight into the mechanisms of milk synthesis. |
format | Online Article Text |
id | pubmed-6271057 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2014 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-62710572018-12-21 GSK3β Regulates Milk Synthesis in and Proliferation of Dairy Cow Mammary Epithelial Cells via the mTOR/S6K1 Signaling Pathway Zhang, Xia Zhao, Feng Si, Yu Huang, Yuling Yu, Cuiping Luo, Chaochao Zhang, Na Li, Qingzhang Gao, Xuejun Molecules Article Glycogen synthase kinase 3 (GSK3) is a serine/threonine kinase, whose activity is inhibited by AKT phosphorylation. This inhibitory phosphorylation of GSK3β can in turn play a regulatory role through phosphorylation of several proteins (such as mTOR, elF2B) to promote protein synthesis. mTOR is a key regulator in protein synthesis and cell proliferation, and recent studies have shown that both GSK3β and mTORC1 can regulate SREBP1 to promote fat synthesis. Thus far, however, the cross talk between GSK3β and the mTOR pathway in the regulation of milk synthesis and associated cell proliferation is not well understood. In this study the interrelationship between GSK3β and the mTOR/S6K1 signaling pathway leading to milk synthesis and proliferation of dairy cow mammary epithelial cells (DCMECs) was analyzed using techniques including GSK3β overexpression by transfection, GSK3β inhibition, mTOR inhibition and methionine stimulation. The analyses revealed that GSK3β represses the mTOR/S6K1 pathway leading to milk synthesis and cell proliferation of DCMECs, whereas GSK3β phosphorylation enhances this pathway. Conversely, the activated mTOR/S6K1 signaling pathway downregulates GSK3β expression but enhances GSK3β phosphorylation to increase milk synthesis and cell proliferation, whereas inhibition of mTOR leads to upregulation of GSK3β and repression of GSK3β phosphorylation, which in turn decreases milk synthesis, and cell proliferation. These findings indicate that GSK3β and phosphorylated GSK3β regulate milk synthesis and proliferation of DCMECs via the mTOR/S6K1 signaling pathway. These findings provide new insight into the mechanisms of milk synthesis. MDPI 2014-07-03 /pmc/articles/PMC6271057/ /pubmed/24995926 http://dx.doi.org/10.3390/molecules19079435 Text en © 2014 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution license (http://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Article Zhang, Xia Zhao, Feng Si, Yu Huang, Yuling Yu, Cuiping Luo, Chaochao Zhang, Na Li, Qingzhang Gao, Xuejun GSK3β Regulates Milk Synthesis in and Proliferation of Dairy Cow Mammary Epithelial Cells via the mTOR/S6K1 Signaling Pathway |
title | GSK3β Regulates Milk Synthesis in and Proliferation of Dairy Cow Mammary Epithelial Cells via the mTOR/S6K1 Signaling Pathway |
title_full | GSK3β Regulates Milk Synthesis in and Proliferation of Dairy Cow Mammary Epithelial Cells via the mTOR/S6K1 Signaling Pathway |
title_fullStr | GSK3β Regulates Milk Synthesis in and Proliferation of Dairy Cow Mammary Epithelial Cells via the mTOR/S6K1 Signaling Pathway |
title_full_unstemmed | GSK3β Regulates Milk Synthesis in and Proliferation of Dairy Cow Mammary Epithelial Cells via the mTOR/S6K1 Signaling Pathway |
title_short | GSK3β Regulates Milk Synthesis in and Proliferation of Dairy Cow Mammary Epithelial Cells via the mTOR/S6K1 Signaling Pathway |
title_sort | gsk3β regulates milk synthesis in and proliferation of dairy cow mammary epithelial cells via the mtor/s6k1 signaling pathway |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6271057/ https://www.ncbi.nlm.nih.gov/pubmed/24995926 http://dx.doi.org/10.3390/molecules19079435 |
work_keys_str_mv | AT zhangxia gsk3bregulatesmilksynthesisinandproliferationofdairycowmammaryepithelialcellsviathemtors6k1signalingpathway AT zhaofeng gsk3bregulatesmilksynthesisinandproliferationofdairycowmammaryepithelialcellsviathemtors6k1signalingpathway AT siyu gsk3bregulatesmilksynthesisinandproliferationofdairycowmammaryepithelialcellsviathemtors6k1signalingpathway AT huangyuling gsk3bregulatesmilksynthesisinandproliferationofdairycowmammaryepithelialcellsviathemtors6k1signalingpathway AT yucuiping gsk3bregulatesmilksynthesisinandproliferationofdairycowmammaryepithelialcellsviathemtors6k1signalingpathway AT luochaochao gsk3bregulatesmilksynthesisinandproliferationofdairycowmammaryepithelialcellsviathemtors6k1signalingpathway AT zhangna gsk3bregulatesmilksynthesisinandproliferationofdairycowmammaryepithelialcellsviathemtors6k1signalingpathway AT liqingzhang gsk3bregulatesmilksynthesisinandproliferationofdairycowmammaryepithelialcellsviathemtors6k1signalingpathway AT gaoxuejun gsk3bregulatesmilksynthesisinandproliferationofdairycowmammaryepithelialcellsviathemtors6k1signalingpathway |