Cargando…

Gene expression profiles of various cytokines in mesenchymal stem cells derived from umbilical cord tissue and bone marrow following infection with human cytomegalovirus

Mesenchymal stem cells (MSCs) have both multi-lineage differentiation potential and immunosuppressive properties, making them ideal candidates for regenerative medicine. However, their immunosuppressive properties potentially increase the risk of cancer progression and opportunistic infections. In t...

Descripción completa

Detalles Bibliográficos
Autores principales: Li, Quansheng, Yu, Ping, Wang, Wei, Zhang, Peng, Yang, Haiqing, Li, Shengfu, Zhang, Li
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Versita 2014
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6275684/
https://www.ncbi.nlm.nih.gov/pubmed/24569981
http://dx.doi.org/10.2478/s11658-014-0187-3
_version_ 1783377854742921216
author Li, Quansheng
Yu, Ping
Wang, Wei
Zhang, Peng
Yang, Haiqing
Li, Shengfu
Zhang, Li
author_facet Li, Quansheng
Yu, Ping
Wang, Wei
Zhang, Peng
Yang, Haiqing
Li, Shengfu
Zhang, Li
author_sort Li, Quansheng
collection PubMed
description Mesenchymal stem cells (MSCs) have both multi-lineage differentiation potential and immunosuppressive properties, making them ideal candidates for regenerative medicine. However, their immunosuppressive properties potentially increase the risk of cancer progression and opportunistic infections. In this study, MSCs isolated from human umbilical cord blood (UCMSCs) and adult bone marrow (BMMSCs) were infected with human cytomegalovirus (HCMV). Cytopathic changes were observed 10 days post infection. PCR products amplified from genomic DNA and cDNA were used to confirm the HCMV infection of the UCMSCs and BMMSCs. Real-time PCR was conducted to quantify the expression of immunomodulatory molecules, including cytokines, chemokines, growth factors, adhesion molecules and cancer-related genes. Our results indicate high upregulation of the majority of these molecules, including many growth factors, tumor necrosis factor alpha, interleukin-8, interleukin-6 and interferon gamma. Adhesion molecules (VCAM-1, TCAM-1 and selectin-E) were downregulated in the infected UCMSCs and BMMSCs. Antibody chip array evaluation of cell culture media indicated that the growth factor secretion by UCMSCs and BMMSCs was greatly influenced (p < 0.001) by HCMV. The stimulation of MSCs with HCMV led to the activation of downstream signaling pathways, including pSTAT3 and Wnt2. Our results show that HCMV can significantly alter the functions of both UCMSCs and BMMSCs, although not in the same way or to the same extent. In both cases, there was an increase in the expression of proangiogenic factors in the microenvironment following HMCV infection. The discrepancy between the two cell types may be explained by their different developmental origin, although further analysis is necessary. Future studies should decipher the underlying mechanism by which HCMV controls MSCs, which may lead to the development of new therapeutic treatments.
format Online
Article
Text
id pubmed-6275684
institution National Center for Biotechnology Information
language English
publishDate 2014
publisher Versita
record_format MEDLINE/PubMed
spelling pubmed-62756842018-12-10 Gene expression profiles of various cytokines in mesenchymal stem cells derived from umbilical cord tissue and bone marrow following infection with human cytomegalovirus Li, Quansheng Yu, Ping Wang, Wei Zhang, Peng Yang, Haiqing Li, Shengfu Zhang, Li Cell Mol Biol Lett Research Article Mesenchymal stem cells (MSCs) have both multi-lineage differentiation potential and immunosuppressive properties, making them ideal candidates for regenerative medicine. However, their immunosuppressive properties potentially increase the risk of cancer progression and opportunistic infections. In this study, MSCs isolated from human umbilical cord blood (UCMSCs) and adult bone marrow (BMMSCs) were infected with human cytomegalovirus (HCMV). Cytopathic changes were observed 10 days post infection. PCR products amplified from genomic DNA and cDNA were used to confirm the HCMV infection of the UCMSCs and BMMSCs. Real-time PCR was conducted to quantify the expression of immunomodulatory molecules, including cytokines, chemokines, growth factors, adhesion molecules and cancer-related genes. Our results indicate high upregulation of the majority of these molecules, including many growth factors, tumor necrosis factor alpha, interleukin-8, interleukin-6 and interferon gamma. Adhesion molecules (VCAM-1, TCAM-1 and selectin-E) were downregulated in the infected UCMSCs and BMMSCs. Antibody chip array evaluation of cell culture media indicated that the growth factor secretion by UCMSCs and BMMSCs was greatly influenced (p < 0.001) by HCMV. The stimulation of MSCs with HCMV led to the activation of downstream signaling pathways, including pSTAT3 and Wnt2. Our results show that HCMV can significantly alter the functions of both UCMSCs and BMMSCs, although not in the same way or to the same extent. In both cases, there was an increase in the expression of proangiogenic factors in the microenvironment following HMCV infection. The discrepancy between the two cell types may be explained by their different developmental origin, although further analysis is necessary. Future studies should decipher the underlying mechanism by which HCMV controls MSCs, which may lead to the development of new therapeutic treatments. Versita 2014-02-25 /pmc/articles/PMC6275684/ /pubmed/24569981 http://dx.doi.org/10.2478/s11658-014-0187-3 Text en © Versita Warsaw and Springer-Verlag Wien 2013
spellingShingle Research Article
Li, Quansheng
Yu, Ping
Wang, Wei
Zhang, Peng
Yang, Haiqing
Li, Shengfu
Zhang, Li
Gene expression profiles of various cytokines in mesenchymal stem cells derived from umbilical cord tissue and bone marrow following infection with human cytomegalovirus
title Gene expression profiles of various cytokines in mesenchymal stem cells derived from umbilical cord tissue and bone marrow following infection with human cytomegalovirus
title_full Gene expression profiles of various cytokines in mesenchymal stem cells derived from umbilical cord tissue and bone marrow following infection with human cytomegalovirus
title_fullStr Gene expression profiles of various cytokines in mesenchymal stem cells derived from umbilical cord tissue and bone marrow following infection with human cytomegalovirus
title_full_unstemmed Gene expression profiles of various cytokines in mesenchymal stem cells derived from umbilical cord tissue and bone marrow following infection with human cytomegalovirus
title_short Gene expression profiles of various cytokines in mesenchymal stem cells derived from umbilical cord tissue and bone marrow following infection with human cytomegalovirus
title_sort gene expression profiles of various cytokines in mesenchymal stem cells derived from umbilical cord tissue and bone marrow following infection with human cytomegalovirus
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6275684/
https://www.ncbi.nlm.nih.gov/pubmed/24569981
http://dx.doi.org/10.2478/s11658-014-0187-3
work_keys_str_mv AT liquansheng geneexpressionprofilesofvariouscytokinesinmesenchymalstemcellsderivedfromumbilicalcordtissueandbonemarrowfollowinginfectionwithhumancytomegalovirus
AT yuping geneexpressionprofilesofvariouscytokinesinmesenchymalstemcellsderivedfromumbilicalcordtissueandbonemarrowfollowinginfectionwithhumancytomegalovirus
AT wangwei geneexpressionprofilesofvariouscytokinesinmesenchymalstemcellsderivedfromumbilicalcordtissueandbonemarrowfollowinginfectionwithhumancytomegalovirus
AT zhangpeng geneexpressionprofilesofvariouscytokinesinmesenchymalstemcellsderivedfromumbilicalcordtissueandbonemarrowfollowinginfectionwithhumancytomegalovirus
AT yanghaiqing geneexpressionprofilesofvariouscytokinesinmesenchymalstemcellsderivedfromumbilicalcordtissueandbonemarrowfollowinginfectionwithhumancytomegalovirus
AT lishengfu geneexpressionprofilesofvariouscytokinesinmesenchymalstemcellsderivedfromumbilicalcordtissueandbonemarrowfollowinginfectionwithhumancytomegalovirus
AT zhangli geneexpressionprofilesofvariouscytokinesinmesenchymalstemcellsderivedfromumbilicalcordtissueandbonemarrowfollowinginfectionwithhumancytomegalovirus