Cargando…
Clinical and genetic characteristics of cystic fibrosis in CHINESE patients: a systemic review of reported cases
Cystic fibrosis (CF) is a rare disease most commonly seen in Caucasians. Only a few Chinese CF patients have been described in literature, taking into account the large population of China. In this systematic review, we collected the clinical and genetic information of 71 Chinese CF patients based o...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6296146/ https://www.ncbi.nlm.nih.gov/pubmed/30558651 http://dx.doi.org/10.1186/s13023-018-0968-2 |
_version_ | 1783380992054001664 |
---|---|
author | Guo, Xiaobei Liu, Keqiang Liu, Yaping Situ, Yusen Tian, Xinlun Xu, Kai-Feng Zhang, Xue |
author_facet | Guo, Xiaobei Liu, Keqiang Liu, Yaping Situ, Yusen Tian, Xinlun Xu, Kai-Feng Zhang, Xue |
author_sort | Guo, Xiaobei |
collection | PubMed |
description | Cystic fibrosis (CF) is a rare disease most commonly seen in Caucasians. Only a few Chinese CF patients have been described in literature, taking into account the large population of China. In this systematic review, we collected the clinical and genetic information of 71 Chinese CF patients based on all available data. Compared with Caucasians, Chinese CF patients often present atypical symptoms, mainly displaying symptoms of pulmonary infection with fewer digestive symptoms. An ethnicity-specific CFTR variant spectrum was also observed in CF patients of Chinese origin, with p.Gly970Asp as the most common mutation while p.Phe508del, the most common pathogenic mutation in CF patients of Caucasian origin, is rare, suggesting the necessity of a Chinese-specific CFTR variant screening panel. Besides, multiplex ligation-dependent probe amplification analysis should be routinely considered, especially for those with unidentified mutations. Potential under-diagnosis of CF in Chinese patients might be caused by a combination of atypical clinical features and genetic heterogeneity in Chinese CF patients, the inaccessibility of sweat and genetic testing facilities, and the one-child policy in China. With the approval of promising small molecule correctors and potentiators, molecular characterization of Chinese-specific CFTR mutations will help to realize more precise treatment for Chinese CF patients. |
format | Online Article Text |
id | pubmed-6296146 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-62961462018-12-18 Clinical and genetic characteristics of cystic fibrosis in CHINESE patients: a systemic review of reported cases Guo, Xiaobei Liu, Keqiang Liu, Yaping Situ, Yusen Tian, Xinlun Xu, Kai-Feng Zhang, Xue Orphanet J Rare Dis Review Cystic fibrosis (CF) is a rare disease most commonly seen in Caucasians. Only a few Chinese CF patients have been described in literature, taking into account the large population of China. In this systematic review, we collected the clinical and genetic information of 71 Chinese CF patients based on all available data. Compared with Caucasians, Chinese CF patients often present atypical symptoms, mainly displaying symptoms of pulmonary infection with fewer digestive symptoms. An ethnicity-specific CFTR variant spectrum was also observed in CF patients of Chinese origin, with p.Gly970Asp as the most common mutation while p.Phe508del, the most common pathogenic mutation in CF patients of Caucasian origin, is rare, suggesting the necessity of a Chinese-specific CFTR variant screening panel. Besides, multiplex ligation-dependent probe amplification analysis should be routinely considered, especially for those with unidentified mutations. Potential under-diagnosis of CF in Chinese patients might be caused by a combination of atypical clinical features and genetic heterogeneity in Chinese CF patients, the inaccessibility of sweat and genetic testing facilities, and the one-child policy in China. With the approval of promising small molecule correctors and potentiators, molecular characterization of Chinese-specific CFTR mutations will help to realize more precise treatment for Chinese CF patients. BioMed Central 2018-12-17 /pmc/articles/PMC6296146/ /pubmed/30558651 http://dx.doi.org/10.1186/s13023-018-0968-2 Text en © The Author(s). 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Review Guo, Xiaobei Liu, Keqiang Liu, Yaping Situ, Yusen Tian, Xinlun Xu, Kai-Feng Zhang, Xue Clinical and genetic characteristics of cystic fibrosis in CHINESE patients: a systemic review of reported cases |
title | Clinical and genetic characteristics of cystic fibrosis in CHINESE patients: a systemic review of reported cases |
title_full | Clinical and genetic characteristics of cystic fibrosis in CHINESE patients: a systemic review of reported cases |
title_fullStr | Clinical and genetic characteristics of cystic fibrosis in CHINESE patients: a systemic review of reported cases |
title_full_unstemmed | Clinical and genetic characteristics of cystic fibrosis in CHINESE patients: a systemic review of reported cases |
title_short | Clinical and genetic characteristics of cystic fibrosis in CHINESE patients: a systemic review of reported cases |
title_sort | clinical and genetic characteristics of cystic fibrosis in chinese patients: a systemic review of reported cases |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6296146/ https://www.ncbi.nlm.nih.gov/pubmed/30558651 http://dx.doi.org/10.1186/s13023-018-0968-2 |
work_keys_str_mv | AT guoxiaobei clinicalandgeneticcharacteristicsofcysticfibrosisinchinesepatientsasystemicreviewofreportedcases AT liukeqiang clinicalandgeneticcharacteristicsofcysticfibrosisinchinesepatientsasystemicreviewofreportedcases AT liuyaping clinicalandgeneticcharacteristicsofcysticfibrosisinchinesepatientsasystemicreviewofreportedcases AT situyusen clinicalandgeneticcharacteristicsofcysticfibrosisinchinesepatientsasystemicreviewofreportedcases AT tianxinlun clinicalandgeneticcharacteristicsofcysticfibrosisinchinesepatientsasystemicreviewofreportedcases AT xukaifeng clinicalandgeneticcharacteristicsofcysticfibrosisinchinesepatientsasystemicreviewofreportedcases AT zhangxue clinicalandgeneticcharacteristicsofcysticfibrosisinchinesepatientsasystemicreviewofreportedcases |