Cargando…

Clinical and genetic characteristics of cystic fibrosis in CHINESE patients: a systemic review of reported cases

Cystic fibrosis (CF) is a rare disease most commonly seen in Caucasians. Only a few Chinese CF patients have been described in literature, taking into account the large population of China. In this systematic review, we collected the clinical and genetic information of 71 Chinese CF patients based o...

Descripción completa

Detalles Bibliográficos
Autores principales: Guo, Xiaobei, Liu, Keqiang, Liu, Yaping, Situ, Yusen, Tian, Xinlun, Xu, Kai-Feng, Zhang, Xue
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6296146/
https://www.ncbi.nlm.nih.gov/pubmed/30558651
http://dx.doi.org/10.1186/s13023-018-0968-2
_version_ 1783380992054001664
author Guo, Xiaobei
Liu, Keqiang
Liu, Yaping
Situ, Yusen
Tian, Xinlun
Xu, Kai-Feng
Zhang, Xue
author_facet Guo, Xiaobei
Liu, Keqiang
Liu, Yaping
Situ, Yusen
Tian, Xinlun
Xu, Kai-Feng
Zhang, Xue
author_sort Guo, Xiaobei
collection PubMed
description Cystic fibrosis (CF) is a rare disease most commonly seen in Caucasians. Only a few Chinese CF patients have been described in literature, taking into account the large population of China. In this systematic review, we collected the clinical and genetic information of 71 Chinese CF patients based on all available data. Compared with Caucasians, Chinese CF patients often present atypical symptoms, mainly displaying symptoms of pulmonary infection with fewer digestive symptoms. An ethnicity-specific CFTR variant spectrum was also observed in CF patients of Chinese origin, with p.Gly970Asp as the most common mutation while p.Phe508del, the most common pathogenic mutation in CF patients of Caucasian origin, is rare, suggesting the necessity of a Chinese-specific CFTR variant screening panel. Besides, multiplex ligation-dependent probe amplification analysis should be routinely considered, especially for those with unidentified mutations. Potential under-diagnosis of CF in Chinese patients might be caused by a combination of atypical clinical features and genetic heterogeneity in Chinese CF patients, the inaccessibility of sweat and genetic testing facilities, and the one-child policy in China. With the approval of promising small molecule correctors and potentiators, molecular characterization of Chinese-specific CFTR mutations will help to realize more precise treatment for Chinese CF patients.
format Online
Article
Text
id pubmed-6296146
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-62961462018-12-18 Clinical and genetic characteristics of cystic fibrosis in CHINESE patients: a systemic review of reported cases Guo, Xiaobei Liu, Keqiang Liu, Yaping Situ, Yusen Tian, Xinlun Xu, Kai-Feng Zhang, Xue Orphanet J Rare Dis Review Cystic fibrosis (CF) is a rare disease most commonly seen in Caucasians. Only a few Chinese CF patients have been described in literature, taking into account the large population of China. In this systematic review, we collected the clinical and genetic information of 71 Chinese CF patients based on all available data. Compared with Caucasians, Chinese CF patients often present atypical symptoms, mainly displaying symptoms of pulmonary infection with fewer digestive symptoms. An ethnicity-specific CFTR variant spectrum was also observed in CF patients of Chinese origin, with p.Gly970Asp as the most common mutation while p.Phe508del, the most common pathogenic mutation in CF patients of Caucasian origin, is rare, suggesting the necessity of a Chinese-specific CFTR variant screening panel. Besides, multiplex ligation-dependent probe amplification analysis should be routinely considered, especially for those with unidentified mutations. Potential under-diagnosis of CF in Chinese patients might be caused by a combination of atypical clinical features and genetic heterogeneity in Chinese CF patients, the inaccessibility of sweat and genetic testing facilities, and the one-child policy in China. With the approval of promising small molecule correctors and potentiators, molecular characterization of Chinese-specific CFTR mutations will help to realize more precise treatment for Chinese CF patients. BioMed Central 2018-12-17 /pmc/articles/PMC6296146/ /pubmed/30558651 http://dx.doi.org/10.1186/s13023-018-0968-2 Text en © The Author(s). 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Review
Guo, Xiaobei
Liu, Keqiang
Liu, Yaping
Situ, Yusen
Tian, Xinlun
Xu, Kai-Feng
Zhang, Xue
Clinical and genetic characteristics of cystic fibrosis in CHINESE patients: a systemic review of reported cases
title Clinical and genetic characteristics of cystic fibrosis in CHINESE patients: a systemic review of reported cases
title_full Clinical and genetic characteristics of cystic fibrosis in CHINESE patients: a systemic review of reported cases
title_fullStr Clinical and genetic characteristics of cystic fibrosis in CHINESE patients: a systemic review of reported cases
title_full_unstemmed Clinical and genetic characteristics of cystic fibrosis in CHINESE patients: a systemic review of reported cases
title_short Clinical and genetic characteristics of cystic fibrosis in CHINESE patients: a systemic review of reported cases
title_sort clinical and genetic characteristics of cystic fibrosis in chinese patients: a systemic review of reported cases
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6296146/
https://www.ncbi.nlm.nih.gov/pubmed/30558651
http://dx.doi.org/10.1186/s13023-018-0968-2
work_keys_str_mv AT guoxiaobei clinicalandgeneticcharacteristicsofcysticfibrosisinchinesepatientsasystemicreviewofreportedcases
AT liukeqiang clinicalandgeneticcharacteristicsofcysticfibrosisinchinesepatientsasystemicreviewofreportedcases
AT liuyaping clinicalandgeneticcharacteristicsofcysticfibrosisinchinesepatientsasystemicreviewofreportedcases
AT situyusen clinicalandgeneticcharacteristicsofcysticfibrosisinchinesepatientsasystemicreviewofreportedcases
AT tianxinlun clinicalandgeneticcharacteristicsofcysticfibrosisinchinesepatientsasystemicreviewofreportedcases
AT xukaifeng clinicalandgeneticcharacteristicsofcysticfibrosisinchinesepatientsasystemicreviewofreportedcases
AT zhangxue clinicalandgeneticcharacteristicsofcysticfibrosisinchinesepatientsasystemicreviewofreportedcases