Cargando…
Amifampridine phosphate in the treatment of muscle-specific kinase myasthenia gravis: a phase IIb, randomized, double-blind, placebo-controlled, double crossover study
OBJECTIVE: The aim of this study is to determine the safety and the efficacy of amifampridine phosphate in muscle-specific kinase antibody-positive myasthenia gravis, in a 1:1 randomized, double-blind, placebo-controlled, switchback, double crossover study. METHODS: Eligible patients had muscle-spec...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
SAGE Publications
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6299310/ https://www.ncbi.nlm.nih.gov/pubmed/30574306 http://dx.doi.org/10.1177/2050312118819013 |
_version_ | 1783381455472164864 |
---|---|
author | Bonanno, Silvia Pasanisi, Maria Barbara Frangiamore, Rita Maggi, Lorenzo Antozzi, Carlo Andreetta, Francesca Campanella, Angela Brenna, Greta Cottini, Lorenzo Mantegazza, Renato |
author_facet | Bonanno, Silvia Pasanisi, Maria Barbara Frangiamore, Rita Maggi, Lorenzo Antozzi, Carlo Andreetta, Francesca Campanella, Angela Brenna, Greta Cottini, Lorenzo Mantegazza, Renato |
author_sort | Bonanno, Silvia |
collection | PubMed |
description | OBJECTIVE: The aim of this study is to determine the safety and the efficacy of amifampridine phosphate in muscle-specific kinase antibody-positive myasthenia gravis, in a 1:1 randomized, double-blind, placebo-controlled, switchback, double crossover study. METHODS: Eligible patients had muscle-specific kinase myasthenia gravis, >18 years of age, and Myasthenia Gravis Foundation of America class II–IV with a score of ⩾9 on Myasthenia Gravis Composite scale. After the run-in phase, during which amifampridine phosphate was titrated to a tolerable and effective dosage, patients were randomized to receive placebo–amifampridine–placebo sequence or amifampridine–placebo–amifampridine sequence daily for 7 days. Then, patients switched treatment arms twice, for a total of 21 days of double-blind treatment. Safety was determined by serial assessments of adverse events/serious adverse events, physical examinations, and clinical and laboratory tests. The co-primary outcome measures included changes from baseline of Quantitative Myasthenia Gravis score and Myasthenia Gravis–specific Activities of Daily Living Profile score. The secondary outcome measures comprised changes from baseline of Myasthenia Gravis Composite score, Myasthenia Gravis Quality of Life scale—15 questions, Fatigue Severity Scale, and Carlo Besta Neurological Institute–Myasthenia Gravis scale. Statistical analyses were assessed using a switchback model for three-period, two-treatment crossover design. RESULTS: A total of 10 patients were screened, enrolled, and treated. Transient paresthesias (60%) were the only amifampridine phosphate–related adverse events reported. Four patients were randomized to receive placebo–amifampridine–placebo sequence and three patients to receive amifampridine–placebo–amifampridine sequence. The co-primary objectives were statistically met (Quantitative Myasthenia Gravis score: p = 0.0003 and Myasthenia Gravis–specific Activities of Daily Living Profile score: p = 0.0006), as well as all the secondary endpoints (Myasthenia Gravis Composite score: p < 0.0001, Myasthenia Gravis Quality of Life scale—15 questions: p = 0.0025, Fatigue Severity Scale: p = 0.0061, and Carlo Besta Neurological Institute–Myasthenia Gravis scale: p = 0.0014). CONCLUSION: Despite the low number of patients, MuSK-001 study provided evidence that amifampridine phosphate, in the range of 30–60 mg daily dose, was safe and effective in treating muscle-specific kinase myasthenia gravis, suggesting the need for a large multi-center trial to confirm these results. |
format | Online Article Text |
id | pubmed-6299310 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | SAGE Publications |
record_format | MEDLINE/PubMed |
spelling | pubmed-62993102018-12-20 Amifampridine phosphate in the treatment of muscle-specific kinase myasthenia gravis: a phase IIb, randomized, double-blind, placebo-controlled, double crossover study Bonanno, Silvia Pasanisi, Maria Barbara Frangiamore, Rita Maggi, Lorenzo Antozzi, Carlo Andreetta, Francesca Campanella, Angela Brenna, Greta Cottini, Lorenzo Mantegazza, Renato SAGE Open Med Original Article OBJECTIVE: The aim of this study is to determine the safety and the efficacy of amifampridine phosphate in muscle-specific kinase antibody-positive myasthenia gravis, in a 1:1 randomized, double-blind, placebo-controlled, switchback, double crossover study. METHODS: Eligible patients had muscle-specific kinase myasthenia gravis, >18 years of age, and Myasthenia Gravis Foundation of America class II–IV with a score of ⩾9 on Myasthenia Gravis Composite scale. After the run-in phase, during which amifampridine phosphate was titrated to a tolerable and effective dosage, patients were randomized to receive placebo–amifampridine–placebo sequence or amifampridine–placebo–amifampridine sequence daily for 7 days. Then, patients switched treatment arms twice, for a total of 21 days of double-blind treatment. Safety was determined by serial assessments of adverse events/serious adverse events, physical examinations, and clinical and laboratory tests. The co-primary outcome measures included changes from baseline of Quantitative Myasthenia Gravis score and Myasthenia Gravis–specific Activities of Daily Living Profile score. The secondary outcome measures comprised changes from baseline of Myasthenia Gravis Composite score, Myasthenia Gravis Quality of Life scale—15 questions, Fatigue Severity Scale, and Carlo Besta Neurological Institute–Myasthenia Gravis scale. Statistical analyses were assessed using a switchback model for three-period, two-treatment crossover design. RESULTS: A total of 10 patients were screened, enrolled, and treated. Transient paresthesias (60%) were the only amifampridine phosphate–related adverse events reported. Four patients were randomized to receive placebo–amifampridine–placebo sequence and three patients to receive amifampridine–placebo–amifampridine sequence. The co-primary objectives were statistically met (Quantitative Myasthenia Gravis score: p = 0.0003 and Myasthenia Gravis–specific Activities of Daily Living Profile score: p = 0.0006), as well as all the secondary endpoints (Myasthenia Gravis Composite score: p < 0.0001, Myasthenia Gravis Quality of Life scale—15 questions: p = 0.0025, Fatigue Severity Scale: p = 0.0061, and Carlo Besta Neurological Institute–Myasthenia Gravis scale: p = 0.0014). CONCLUSION: Despite the low number of patients, MuSK-001 study provided evidence that amifampridine phosphate, in the range of 30–60 mg daily dose, was safe and effective in treating muscle-specific kinase myasthenia gravis, suggesting the need for a large multi-center trial to confirm these results. SAGE Publications 2018-12-17 /pmc/articles/PMC6299310/ /pubmed/30574306 http://dx.doi.org/10.1177/2050312118819013 Text en © The Author(s) 2018 http://www.creativecommons.org/licenses/by-nc/4.0/ This article is distributed under the terms of the Creative Commons Attribution-NonCommercial 4.0 License (http://www.creativecommons.org/licenses/by-nc/4.0/) which permits non-commercial use, reproduction and distribution of the work without further permission provided the original work is attributed as specified on the SAGE and Open Access pages (https://us.sagepub.com/en-us/nam/open-access-at-sage). |
spellingShingle | Original Article Bonanno, Silvia Pasanisi, Maria Barbara Frangiamore, Rita Maggi, Lorenzo Antozzi, Carlo Andreetta, Francesca Campanella, Angela Brenna, Greta Cottini, Lorenzo Mantegazza, Renato Amifampridine phosphate in the treatment of muscle-specific kinase myasthenia gravis: a phase IIb, randomized, double-blind, placebo-controlled, double crossover study |
title | Amifampridine phosphate in the treatment of muscle-specific kinase myasthenia gravis: a phase IIb, randomized, double-blind, placebo-controlled, double crossover study |
title_full | Amifampridine phosphate in the treatment of muscle-specific kinase myasthenia gravis: a phase IIb, randomized, double-blind, placebo-controlled, double crossover study |
title_fullStr | Amifampridine phosphate in the treatment of muscle-specific kinase myasthenia gravis: a phase IIb, randomized, double-blind, placebo-controlled, double crossover study |
title_full_unstemmed | Amifampridine phosphate in the treatment of muscle-specific kinase myasthenia gravis: a phase IIb, randomized, double-blind, placebo-controlled, double crossover study |
title_short | Amifampridine phosphate in the treatment of muscle-specific kinase myasthenia gravis: a phase IIb, randomized, double-blind, placebo-controlled, double crossover study |
title_sort | amifampridine phosphate in the treatment of muscle-specific kinase myasthenia gravis: a phase iib, randomized, double-blind, placebo-controlled, double crossover study |
topic | Original Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6299310/ https://www.ncbi.nlm.nih.gov/pubmed/30574306 http://dx.doi.org/10.1177/2050312118819013 |
work_keys_str_mv | AT bonannosilvia amifampridinephosphateinthetreatmentofmusclespecifickinasemyastheniagravisaphaseiibrandomizeddoubleblindplacebocontrolleddoublecrossoverstudy AT pasanisimariabarbara amifampridinephosphateinthetreatmentofmusclespecifickinasemyastheniagravisaphaseiibrandomizeddoubleblindplacebocontrolleddoublecrossoverstudy AT frangiamorerita amifampridinephosphateinthetreatmentofmusclespecifickinasemyastheniagravisaphaseiibrandomizeddoubleblindplacebocontrolleddoublecrossoverstudy AT maggilorenzo amifampridinephosphateinthetreatmentofmusclespecifickinasemyastheniagravisaphaseiibrandomizeddoubleblindplacebocontrolleddoublecrossoverstudy AT antozzicarlo amifampridinephosphateinthetreatmentofmusclespecifickinasemyastheniagravisaphaseiibrandomizeddoubleblindplacebocontrolleddoublecrossoverstudy AT andreettafrancesca amifampridinephosphateinthetreatmentofmusclespecifickinasemyastheniagravisaphaseiibrandomizeddoubleblindplacebocontrolleddoublecrossoverstudy AT campanellaangela amifampridinephosphateinthetreatmentofmusclespecifickinasemyastheniagravisaphaseiibrandomizeddoubleblindplacebocontrolleddoublecrossoverstudy AT brennagreta amifampridinephosphateinthetreatmentofmusclespecifickinasemyastheniagravisaphaseiibrandomizeddoubleblindplacebocontrolleddoublecrossoverstudy AT cottinilorenzo amifampridinephosphateinthetreatmentofmusclespecifickinasemyastheniagravisaphaseiibrandomizeddoubleblindplacebocontrolleddoublecrossoverstudy AT mantegazzarenato amifampridinephosphateinthetreatmentofmusclespecifickinasemyastheniagravisaphaseiibrandomizeddoubleblindplacebocontrolleddoublecrossoverstudy |