Cargando…
Automated computed tomographic scoring of lung disease in adults with primary ciliary dyskinesia
BACKGROUND: The present study aimed to develop an automated computed tomography (CT) score based on the CT quantification of high-attenuating lung structures, in order to provide a quantitative assessment of lung structural abnormalities in patients with Primary Ciliary Dyskinesia (PCD). METHODS: Ad...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6299576/ https://www.ncbi.nlm.nih.gov/pubmed/30563485 http://dx.doi.org/10.1186/s12890-018-0758-6 |
_version_ | 1783381514210246656 |
---|---|
author | Hoang-Thi, Trieu-Nghi Revel, Marie-Pierre Burgel, Pierre-Régis Bassinet, Laurence Honoré, Isabelle Hua-Huy, Thong Martin, Charlotte Maitre, Bernard Chassagnon, Guillaume |
author_facet | Hoang-Thi, Trieu-Nghi Revel, Marie-Pierre Burgel, Pierre-Régis Bassinet, Laurence Honoré, Isabelle Hua-Huy, Thong Martin, Charlotte Maitre, Bernard Chassagnon, Guillaume |
author_sort | Hoang-Thi, Trieu-Nghi |
collection | PubMed |
description | BACKGROUND: The present study aimed to develop an automated computed tomography (CT) score based on the CT quantification of high-attenuating lung structures, in order to provide a quantitative assessment of lung structural abnormalities in patients with Primary Ciliary Dyskinesia (PCD). METHODS: Adult (≥18 years) PCD patients who underwent both chest CT and spirometry within a 6-month period were retrospectively included. Commercially available lung segmentation software was used to isolate the lungs from the mediastinum and chest wall and obtain histograms of lung density. CT-density scores were calculated using fixed and adapted thresholds based on various combinations of histogram characteristics, such as mean lung density (MLD), skewness, and standard deviation (SD). Additionally, visual scoring using the Bhalla score was performed by 2 independent radiologists. Correlations between CT scores, forced expiratory volume in 1 s (FEV(1)) and forced vital capacity (FVC) were evaluated. RESULTS: Sixty-two adult patients with PCD were included. Of all histogram characteristics, those showing good positive or negative correlations to both FEV(1) and FVC were SD (R = − 0.63 and − 0.67; p < 0.001) and Skewness (R = 0.67 and 0.67; p < 0.001). Among all evaluated thresholds, the CT-density score based on MLD + 1SD provided the best negative correlation with both FEV(1) (R = − 0.68; p < 0.001) and FVC (R = − 0.71; p < 0.001), close to the correlations of the visual score (R = − 0.60; p < 0.001 for FEV(1) and R = − 0.62; p < 0.001, for FVC). CONCLUSIONS: Automated CT scoring of lung structural abnormalities lung in primary ciliary dyskinesia is feasible and may prove useful for evaluation of disease severity in the clinic and in clinical trials. |
format | Online Article Text |
id | pubmed-6299576 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-62995762018-12-20 Automated computed tomographic scoring of lung disease in adults with primary ciliary dyskinesia Hoang-Thi, Trieu-Nghi Revel, Marie-Pierre Burgel, Pierre-Régis Bassinet, Laurence Honoré, Isabelle Hua-Huy, Thong Martin, Charlotte Maitre, Bernard Chassagnon, Guillaume BMC Pulm Med Research Article BACKGROUND: The present study aimed to develop an automated computed tomography (CT) score based on the CT quantification of high-attenuating lung structures, in order to provide a quantitative assessment of lung structural abnormalities in patients with Primary Ciliary Dyskinesia (PCD). METHODS: Adult (≥18 years) PCD patients who underwent both chest CT and spirometry within a 6-month period were retrospectively included. Commercially available lung segmentation software was used to isolate the lungs from the mediastinum and chest wall and obtain histograms of lung density. CT-density scores were calculated using fixed and adapted thresholds based on various combinations of histogram characteristics, such as mean lung density (MLD), skewness, and standard deviation (SD). Additionally, visual scoring using the Bhalla score was performed by 2 independent radiologists. Correlations between CT scores, forced expiratory volume in 1 s (FEV(1)) and forced vital capacity (FVC) were evaluated. RESULTS: Sixty-two adult patients with PCD were included. Of all histogram characteristics, those showing good positive or negative correlations to both FEV(1) and FVC were SD (R = − 0.63 and − 0.67; p < 0.001) and Skewness (R = 0.67 and 0.67; p < 0.001). Among all evaluated thresholds, the CT-density score based on MLD + 1SD provided the best negative correlation with both FEV(1) (R = − 0.68; p < 0.001) and FVC (R = − 0.71; p < 0.001), close to the correlations of the visual score (R = − 0.60; p < 0.001 for FEV(1) and R = − 0.62; p < 0.001, for FVC). CONCLUSIONS: Automated CT scoring of lung structural abnormalities lung in primary ciliary dyskinesia is feasible and may prove useful for evaluation of disease severity in the clinic and in clinical trials. BioMed Central 2018-12-18 /pmc/articles/PMC6299576/ /pubmed/30563485 http://dx.doi.org/10.1186/s12890-018-0758-6 Text en © The Author(s). 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Hoang-Thi, Trieu-Nghi Revel, Marie-Pierre Burgel, Pierre-Régis Bassinet, Laurence Honoré, Isabelle Hua-Huy, Thong Martin, Charlotte Maitre, Bernard Chassagnon, Guillaume Automated computed tomographic scoring of lung disease in adults with primary ciliary dyskinesia |
title | Automated computed tomographic scoring of lung disease in adults with primary ciliary dyskinesia |
title_full | Automated computed tomographic scoring of lung disease in adults with primary ciliary dyskinesia |
title_fullStr | Automated computed tomographic scoring of lung disease in adults with primary ciliary dyskinesia |
title_full_unstemmed | Automated computed tomographic scoring of lung disease in adults with primary ciliary dyskinesia |
title_short | Automated computed tomographic scoring of lung disease in adults with primary ciliary dyskinesia |
title_sort | automated computed tomographic scoring of lung disease in adults with primary ciliary dyskinesia |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6299576/ https://www.ncbi.nlm.nih.gov/pubmed/30563485 http://dx.doi.org/10.1186/s12890-018-0758-6 |
work_keys_str_mv | AT hoangthitrieunghi automatedcomputedtomographicscoringoflungdiseaseinadultswithprimaryciliarydyskinesia AT revelmariepierre automatedcomputedtomographicscoringoflungdiseaseinadultswithprimaryciliarydyskinesia AT burgelpierreregis automatedcomputedtomographicscoringoflungdiseaseinadultswithprimaryciliarydyskinesia AT bassinetlaurence automatedcomputedtomographicscoringoflungdiseaseinadultswithprimaryciliarydyskinesia AT honoreisabelle automatedcomputedtomographicscoringoflungdiseaseinadultswithprimaryciliarydyskinesia AT huahuythong automatedcomputedtomographicscoringoflungdiseaseinadultswithprimaryciliarydyskinesia AT martincharlotte automatedcomputedtomographicscoringoflungdiseaseinadultswithprimaryciliarydyskinesia AT maitrebernard automatedcomputedtomographicscoringoflungdiseaseinadultswithprimaryciliarydyskinesia AT chassagnonguillaume automatedcomputedtomographicscoringoflungdiseaseinadultswithprimaryciliarydyskinesia |