Cargando…
Influence of social characteristics on use of paediatric emergency care in Sweden - a questionnaire based study
BACKGROUND: Parental social characteristics influence the use of emergency departments (ED) in the USA, but less is known about paediatric ED care-seeking in countries with national health insurance. This prospective study was designed to evaluate associations between parental care-seeking and socia...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6307227/ https://www.ncbi.nlm.nih.gov/pubmed/30587134 http://dx.doi.org/10.1186/s12873-018-0210-5 |
_version_ | 1783382959110225920 |
---|---|
author | Ellbrant, Julia Åkeson, Jonas Eckner, Jenny Karlsland Åkeson, Pia |
author_facet | Ellbrant, Julia Åkeson, Jonas Eckner, Jenny Karlsland Åkeson, Pia |
author_sort | Ellbrant, Julia |
collection | PubMed |
description | BACKGROUND: Parental social characteristics influence the use of emergency departments (ED) in the USA, but less is known about paediatric ED care-seeking in countries with national health insurance. This prospective study was designed to evaluate associations between parental care-seeking and social characteristics, with emphasis on impact of non-native origin, at a paediatric ED in Sweden, a European country providing paediatric healthcare free of charge. METHODS: Parents attending a paediatric ED at a large urban university hospital filled out a questionnaire on social characteristics and reasons for care-seeking. Information on patient characteristics and initial management was obtained from ED registers and patient records. Paediatric ED physicians assessed the medical appropriateness of each patient visit triaged for ED care. RESULTS: In total, 962 patient visits were included. Telephone healthline service before the paediatric ED visit was less often used by non-native parents (63/345 vs. 249/544, p < 0.001). Low-aquity visits, triaged away from the ED, were more common among non-native parents (80/368 vs. 67/555, OR = 1.66; p = 0.018), and among those reporting lower abilities in the Swedish language (23/82 vs. 120/837, OR = 2.66; p = 0.003). Children of non-native parents were more often assessed by physicians not to require ED care (122/335 vs. 261/512, OR = 0.70; p = 0.028). CONCLUSIONS: This study confirms more direct and less urgent use of paediatric ED care by parents of non-native origin or with limited abilities in the Swedish language, proposing that parental social characteristics influence paediatric ED care-seeking, also in a country with healthcare free of charge, and that specific needs of these groups should be better met by prehospital medical services. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12873-018-0210-5) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-6307227 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-63072272019-01-02 Influence of social characteristics on use of paediatric emergency care in Sweden - a questionnaire based study Ellbrant, Julia Åkeson, Jonas Eckner, Jenny Karlsland Åkeson, Pia BMC Emerg Med Research Article BACKGROUND: Parental social characteristics influence the use of emergency departments (ED) in the USA, but less is known about paediatric ED care-seeking in countries with national health insurance. This prospective study was designed to evaluate associations between parental care-seeking and social characteristics, with emphasis on impact of non-native origin, at a paediatric ED in Sweden, a European country providing paediatric healthcare free of charge. METHODS: Parents attending a paediatric ED at a large urban university hospital filled out a questionnaire on social characteristics and reasons for care-seeking. Information on patient characteristics and initial management was obtained from ED registers and patient records. Paediatric ED physicians assessed the medical appropriateness of each patient visit triaged for ED care. RESULTS: In total, 962 patient visits were included. Telephone healthline service before the paediatric ED visit was less often used by non-native parents (63/345 vs. 249/544, p < 0.001). Low-aquity visits, triaged away from the ED, were more common among non-native parents (80/368 vs. 67/555, OR = 1.66; p = 0.018), and among those reporting lower abilities in the Swedish language (23/82 vs. 120/837, OR = 2.66; p = 0.003). Children of non-native parents were more often assessed by physicians not to require ED care (122/335 vs. 261/512, OR = 0.70; p = 0.028). CONCLUSIONS: This study confirms more direct and less urgent use of paediatric ED care by parents of non-native origin or with limited abilities in the Swedish language, proposing that parental social characteristics influence paediatric ED care-seeking, also in a country with healthcare free of charge, and that specific needs of these groups should be better met by prehospital medical services. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12873-018-0210-5) contains supplementary material, which is available to authorized users. BioMed Central 2018-12-27 /pmc/articles/PMC6307227/ /pubmed/30587134 http://dx.doi.org/10.1186/s12873-018-0210-5 Text en © The Author(s). 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Ellbrant, Julia Åkeson, Jonas Eckner, Jenny Karlsland Åkeson, Pia Influence of social characteristics on use of paediatric emergency care in Sweden - a questionnaire based study |
title | Influence of social characteristics on use of paediatric emergency care in Sweden - a questionnaire based study |
title_full | Influence of social characteristics on use of paediatric emergency care in Sweden - a questionnaire based study |
title_fullStr | Influence of social characteristics on use of paediatric emergency care in Sweden - a questionnaire based study |
title_full_unstemmed | Influence of social characteristics on use of paediatric emergency care in Sweden - a questionnaire based study |
title_short | Influence of social characteristics on use of paediatric emergency care in Sweden - a questionnaire based study |
title_sort | influence of social characteristics on use of paediatric emergency care in sweden - a questionnaire based study |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6307227/ https://www.ncbi.nlm.nih.gov/pubmed/30587134 http://dx.doi.org/10.1186/s12873-018-0210-5 |
work_keys_str_mv | AT ellbrantjulia influenceofsocialcharacteristicsonuseofpaediatricemergencycareinswedenaquestionnairebasedstudy AT akesonjonas influenceofsocialcharacteristicsonuseofpaediatricemergencycareinswedenaquestionnairebasedstudy AT ecknerjenny influenceofsocialcharacteristicsonuseofpaediatricemergencycareinswedenaquestionnairebasedstudy AT karlslandakesonpia influenceofsocialcharacteristicsonuseofpaediatricemergencycareinswedenaquestionnairebasedstudy |