Cargando…

Air pollution and female fertility: a systematic review of literature

Air pollution is a cause of concern for human health. For instance, it is associated with an increased risk for cancer, cardiovascular and respiratory disorders. In vitro and in vivo studies suggested that air pollutants could act as endocrine disruptors, promote oxidative stress and exert genotoxic...

Descripción completa

Detalles Bibliográficos
Autores principales: Conforti, Alessandro, Mascia, Marika, Cioffi, Giuseppina, De Angelis, Cristina, Coppola, Giuseppe, De Rosa, Pasquale, Pivonello, Rosario, Alviggi, Carlo, De Placido, Giuseppe
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6311303/
https://www.ncbi.nlm.nih.gov/pubmed/30594197
http://dx.doi.org/10.1186/s12958-018-0433-z
_version_ 1783383591020920832
author Conforti, Alessandro
Mascia, Marika
Cioffi, Giuseppina
De Angelis, Cristina
Coppola, Giuseppe
De Rosa, Pasquale
Pivonello, Rosario
Alviggi, Carlo
De Placido, Giuseppe
author_facet Conforti, Alessandro
Mascia, Marika
Cioffi, Giuseppina
De Angelis, Cristina
Coppola, Giuseppe
De Rosa, Pasquale
Pivonello, Rosario
Alviggi, Carlo
De Placido, Giuseppe
author_sort Conforti, Alessandro
collection PubMed
description Air pollution is a cause of concern for human health. For instance, it is associated with an increased risk for cancer, cardiovascular and respiratory disorders. In vitro and in vivo studies suggested that air pollutants could act as endocrine disruptors, promote oxidative stress and exert genotoxic effect. Whether air pollution affects female infertility is under debate. The aim of the present study was to conduct a systematic review of studies that evaluated the impact of air pollution on female infertility. We systematically searched the MEDLINE (PubMed) and SCOPUS databases to identify all relevant studies published before October 2017. No time or language restrictions were adopted, and queries were limited to human studies. We also hand-searched the reference lists of relevant studies to ensure we did not miss pertinent studies. The risk of bias and quality assessment of the studies identified were performed using the Newcastle-Ottawa Scale. Primary outcomes were conception rate after spontaneous intercourse and live birth rate after in vitro fertilization (IVF) procedures. Secondary outcomes were first trimester miscarriage, stillbirths, infertility, number of oocytes and embryo retrieved. Eleven articles were included in the analysis. We found that in the IVF population, nitrogen dioxide and ozone were associated with a reduced live birth rate while particulate matter of 10 mm was associated with increased miscarriage. Furthermore, in the general population, particulate matter of 2.5 mm and between 2.5 and 10 mm were associated with reduced fecundability, whereas sulfur dioxide(,) carbon monoxide and nitrogen dioxide might promote miscarriage and stillbirths. The main limitation of our findigns resides in the fact that the desegn of studies included are observational and retrospective. Furthermore, there was a wide heterogenity among studies. Although larger trials are required before drawing definitive conclusions, it seems that air pollution could represent a matter of concern for female infertility. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12958-018-0433-z) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-6311303
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-63113032019-01-07 Air pollution and female fertility: a systematic review of literature Conforti, Alessandro Mascia, Marika Cioffi, Giuseppina De Angelis, Cristina Coppola, Giuseppe De Rosa, Pasquale Pivonello, Rosario Alviggi, Carlo De Placido, Giuseppe Reprod Biol Endocrinol Review Air pollution is a cause of concern for human health. For instance, it is associated with an increased risk for cancer, cardiovascular and respiratory disorders. In vitro and in vivo studies suggested that air pollutants could act as endocrine disruptors, promote oxidative stress and exert genotoxic effect. Whether air pollution affects female infertility is under debate. The aim of the present study was to conduct a systematic review of studies that evaluated the impact of air pollution on female infertility. We systematically searched the MEDLINE (PubMed) and SCOPUS databases to identify all relevant studies published before October 2017. No time or language restrictions were adopted, and queries were limited to human studies. We also hand-searched the reference lists of relevant studies to ensure we did not miss pertinent studies. The risk of bias and quality assessment of the studies identified were performed using the Newcastle-Ottawa Scale. Primary outcomes were conception rate after spontaneous intercourse and live birth rate after in vitro fertilization (IVF) procedures. Secondary outcomes were first trimester miscarriage, stillbirths, infertility, number of oocytes and embryo retrieved. Eleven articles were included in the analysis. We found that in the IVF population, nitrogen dioxide and ozone were associated with a reduced live birth rate while particulate matter of 10 mm was associated with increased miscarriage. Furthermore, in the general population, particulate matter of 2.5 mm and between 2.5 and 10 mm were associated with reduced fecundability, whereas sulfur dioxide(,) carbon monoxide and nitrogen dioxide might promote miscarriage and stillbirths. The main limitation of our findigns resides in the fact that the desegn of studies included are observational and retrospective. Furthermore, there was a wide heterogenity among studies. Although larger trials are required before drawing definitive conclusions, it seems that air pollution could represent a matter of concern for female infertility. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12958-018-0433-z) contains supplementary material, which is available to authorized users. BioMed Central 2018-12-30 /pmc/articles/PMC6311303/ /pubmed/30594197 http://dx.doi.org/10.1186/s12958-018-0433-z Text en © The Author(s). 2018 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Review
Conforti, Alessandro
Mascia, Marika
Cioffi, Giuseppina
De Angelis, Cristina
Coppola, Giuseppe
De Rosa, Pasquale
Pivonello, Rosario
Alviggi, Carlo
De Placido, Giuseppe
Air pollution and female fertility: a systematic review of literature
title Air pollution and female fertility: a systematic review of literature
title_full Air pollution and female fertility: a systematic review of literature
title_fullStr Air pollution and female fertility: a systematic review of literature
title_full_unstemmed Air pollution and female fertility: a systematic review of literature
title_short Air pollution and female fertility: a systematic review of literature
title_sort air pollution and female fertility: a systematic review of literature
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6311303/
https://www.ncbi.nlm.nih.gov/pubmed/30594197
http://dx.doi.org/10.1186/s12958-018-0433-z
work_keys_str_mv AT confortialessandro airpollutionandfemalefertilityasystematicreviewofliterature
AT masciamarika airpollutionandfemalefertilityasystematicreviewofliterature
AT cioffigiuseppina airpollutionandfemalefertilityasystematicreviewofliterature
AT deangeliscristina airpollutionandfemalefertilityasystematicreviewofliterature
AT coppolagiuseppe airpollutionandfemalefertilityasystematicreviewofliterature
AT derosapasquale airpollutionandfemalefertilityasystematicreviewofliterature
AT pivonellorosario airpollutionandfemalefertilityasystematicreviewofliterature
AT alviggicarlo airpollutionandfemalefertilityasystematicreviewofliterature
AT deplacidogiuseppe airpollutionandfemalefertilityasystematicreviewofliterature