Cargando…

Traditional Chinese medicine classic herbal formula Xiaoqinglong decoction for acute exacerbation of chronic obstructive pulmonary disease: A systematic review protocol

BACKGROUND: Xiaoqinglong decoction (XQLD) is 1 of the traditional Chinese medicine (TCM) classic herbal formula that is widely used in Asian for acute exacerbation of chronic obstructive pulmonary disease (AECOPD). In recent years, there has been increasing interest in the use of XQLD to treat COPD...

Descripción completa

Detalles Bibliográficos
Autores principales: Zhen, Gao, Jing, Jing, Fengsen, Li
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Wolters Kluwer Health 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6314719/
https://www.ncbi.nlm.nih.gov/pubmed/30593152
http://dx.doi.org/10.1097/MD.0000000000013761
_version_ 1783384148163952640
author Zhen, Gao
Jing, Jing
Fengsen, Li
author_facet Zhen, Gao
Jing, Jing
Fengsen, Li
author_sort Zhen, Gao
collection PubMed
description BACKGROUND: Xiaoqinglong decoction (XQLD) is 1 of the traditional Chinese medicine (TCM) classic herbal formula that is widely used in Asian for acute exacerbation of chronic obstructive pulmonary disease (AECOPD). In recent years, there has been increasing interest in the use of XQLD to treat COPD in China. So it is necessary to update the research and re-evaluate the efficacy and safety of XQLD to provide up-to-date evidence for COPD management. Therefore, we provide a protocol for a systematic review of XQLD for COPD. This protocol is described for a systematic review to investigate the beneficial effects and safety of XQLD for AECOPD. METHODS: A systematic literature search for article up to October 2018 will be performed in 3 Chinese electronic databases and 2 English electronic databases: Pubmed, Cochrane library, China national knowledge infrastructure (CNKI), Chinese science and technology periodical database (VIP), and Wanfang database. Inclusion criteria are randomized control trials of XQLD in treating AECOPD. The primary outcomes were total clinical efficacy rate, TCM symptom scores, TCM Symptom relief time. The secondary outcome was lung function, blood gas analysis, inflammatory cytokines and C-reactive protein (CRP). The summary results will be pooled using the random-effects model or fixed-effects model according to the heterogeneity of the included studies. RESULT: This systematic review will provide an evidence of XQLD for AECOPD, and will submit to a peer-reviewed journal for publication. CONCLUSION: The conclusion of this systematic review will provide evidence to judge whether XQLD is an effective intervention for AECOPD patients.
format Online
Article
Text
id pubmed-6314719
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher Wolters Kluwer Health
record_format MEDLINE/PubMed
spelling pubmed-63147192019-01-14 Traditional Chinese medicine classic herbal formula Xiaoqinglong decoction for acute exacerbation of chronic obstructive pulmonary disease: A systematic review protocol Zhen, Gao Jing, Jing Fengsen, Li Medicine (Baltimore) Research Article BACKGROUND: Xiaoqinglong decoction (XQLD) is 1 of the traditional Chinese medicine (TCM) classic herbal formula that is widely used in Asian for acute exacerbation of chronic obstructive pulmonary disease (AECOPD). In recent years, there has been increasing interest in the use of XQLD to treat COPD in China. So it is necessary to update the research and re-evaluate the efficacy and safety of XQLD to provide up-to-date evidence for COPD management. Therefore, we provide a protocol for a systematic review of XQLD for COPD. This protocol is described for a systematic review to investigate the beneficial effects and safety of XQLD for AECOPD. METHODS: A systematic literature search for article up to October 2018 will be performed in 3 Chinese electronic databases and 2 English electronic databases: Pubmed, Cochrane library, China national knowledge infrastructure (CNKI), Chinese science and technology periodical database (VIP), and Wanfang database. Inclusion criteria are randomized control trials of XQLD in treating AECOPD. The primary outcomes were total clinical efficacy rate, TCM symptom scores, TCM Symptom relief time. The secondary outcome was lung function, blood gas analysis, inflammatory cytokines and C-reactive protein (CRP). The summary results will be pooled using the random-effects model or fixed-effects model according to the heterogeneity of the included studies. RESULT: This systematic review will provide an evidence of XQLD for AECOPD, and will submit to a peer-reviewed journal for publication. CONCLUSION: The conclusion of this systematic review will provide evidence to judge whether XQLD is an effective intervention for AECOPD patients. Wolters Kluwer Health 2018-12-28 /pmc/articles/PMC6314719/ /pubmed/30593152 http://dx.doi.org/10.1097/MD.0000000000013761 Text en Copyright © 2018 the Author(s). Published by Wolters Kluwer Health, Inc. http://creativecommons.org/licenses/by/4.0 This is an open access article distributed under the Creative Commons Attribution License 4.0 (CCBY), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. http://creativecommons.org/licenses/by/4.0
spellingShingle Research Article
Zhen, Gao
Jing, Jing
Fengsen, Li
Traditional Chinese medicine classic herbal formula Xiaoqinglong decoction for acute exacerbation of chronic obstructive pulmonary disease: A systematic review protocol
title Traditional Chinese medicine classic herbal formula Xiaoqinglong decoction for acute exacerbation of chronic obstructive pulmonary disease: A systematic review protocol
title_full Traditional Chinese medicine classic herbal formula Xiaoqinglong decoction for acute exacerbation of chronic obstructive pulmonary disease: A systematic review protocol
title_fullStr Traditional Chinese medicine classic herbal formula Xiaoqinglong decoction for acute exacerbation of chronic obstructive pulmonary disease: A systematic review protocol
title_full_unstemmed Traditional Chinese medicine classic herbal formula Xiaoqinglong decoction for acute exacerbation of chronic obstructive pulmonary disease: A systematic review protocol
title_short Traditional Chinese medicine classic herbal formula Xiaoqinglong decoction for acute exacerbation of chronic obstructive pulmonary disease: A systematic review protocol
title_sort traditional chinese medicine classic herbal formula xiaoqinglong decoction for acute exacerbation of chronic obstructive pulmonary disease: a systematic review protocol
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6314719/
https://www.ncbi.nlm.nih.gov/pubmed/30593152
http://dx.doi.org/10.1097/MD.0000000000013761
work_keys_str_mv AT zhengao traditionalchinesemedicineclassicherbalformulaxiaoqinglongdecoctionforacuteexacerbationofchronicobstructivepulmonarydiseaseasystematicreviewprotocol
AT jingjing traditionalchinesemedicineclassicherbalformulaxiaoqinglongdecoctionforacuteexacerbationofchronicobstructivepulmonarydiseaseasystematicreviewprotocol
AT fengsenli traditionalchinesemedicineclassicherbalformulaxiaoqinglongdecoctionforacuteexacerbationofchronicobstructivepulmonarydiseaseasystematicreviewprotocol