Cargando…

A retinoid X receptor partial agonist attenuates pulmonary emphysema and airway inflammation

BACKGROUND: Retinoid X receptors (RXRs) are members of the nuclear receptor (NR) superfamily that mediate signalling by 9-cis retinoic acid, a vitamin A derivative. RXRs play key roles not only as homodimers but also as heterodimeric partners, e.g., for retinoic acid receptors, vitamin D receptors,...

Descripción completa

Detalles Bibliográficos
Autores principales: Morichika, Daisuke, Miyahara, Nobuaki, Fujii, Utako, Taniguchi, Akihiko, Oda, Naohiro, Senoo, Satoru, Kataoka, Mikio, Tanimoto, Mitsune, Kakuta, Hiroki, Kiura, Katsuyuki, Maeda, Yoshinobu, Kanehiro, Arihiko
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6318915/
https://www.ncbi.nlm.nih.gov/pubmed/30606200
http://dx.doi.org/10.1186/s12931-018-0963-0
_version_ 1783384970590420992
author Morichika, Daisuke
Miyahara, Nobuaki
Fujii, Utako
Taniguchi, Akihiko
Oda, Naohiro
Senoo, Satoru
Kataoka, Mikio
Tanimoto, Mitsune
Kakuta, Hiroki
Kiura, Katsuyuki
Maeda, Yoshinobu
Kanehiro, Arihiko
author_facet Morichika, Daisuke
Miyahara, Nobuaki
Fujii, Utako
Taniguchi, Akihiko
Oda, Naohiro
Senoo, Satoru
Kataoka, Mikio
Tanimoto, Mitsune
Kakuta, Hiroki
Kiura, Katsuyuki
Maeda, Yoshinobu
Kanehiro, Arihiko
author_sort Morichika, Daisuke
collection PubMed
description BACKGROUND: Retinoid X receptors (RXRs) are members of the nuclear receptor (NR) superfamily that mediate signalling by 9-cis retinoic acid, a vitamin A derivative. RXRs play key roles not only as homodimers but also as heterodimeric partners, e.g., for retinoic acid receptors, vitamin D receptors, and peroxisome proliferator-activated receptors. The NR family may also play important roles in the development of emphysema. However, the role of RXRs in the pathogenesis of emphysema is not well defined. METHODS: We developed a novel RXR partial agonist (NEt-4IB) and investigated its effect and mechanism compared to a full agonist (bexarotene) in a murine model of emphysema. For emphysema induction, BALB/c mice received intraperitoneal cigarette smoke extract (CSE) or intratracheal porcine pancreas elastase (PPE). Treatment with RXR agonists was initiated before or after emphysema induction. RESULTS: Treatment with NEt-4IB significantly suppressed the increase in static lung compliance and emphysematous changes in CSE-induced emphysema and PPE-induced established and progressive emphysema. NEt-4IB significantly suppressed PPE-induced neutrophilic airway inflammation and the levels of keratinocyte chemoattractant (KC), C-X-C motif ligand5 (CXCL5), interferon (IFN)-γ and IL-17. NEt-4IB also improved the matrix metalloproteinase-9 (MMP-9)/tissue inhibitor of metalloproteinase-1 (TIMP-1) imbalance and the reduced anti-oxidant activity in bronchoalveolar lavage (BAL) fluid. NEt-4IB suppressed PPE-induced vascular endothelial growth factor (VEGF) expression in the airway. Treatment with NEt-4IB and bexarotene significantly suppressed the increase in static lung compliance and emphysematous changes. However, adverse effects of RXR agonists, including hypertriglyceridemia and hepatomegaly, were observed in bexarotene-treated mice but not in NEt-4IB-treated mice. CONCLUSION: These data suggest that RXRs play crucial roles in emphysema and airway inflammation, and novel partial RXR agonists could be potential therapeutic strategies for the treatment of PPE- and CSE-induced emphysema. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12931-018-0963-0) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-6318915
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-63189152019-01-08 A retinoid X receptor partial agonist attenuates pulmonary emphysema and airway inflammation Morichika, Daisuke Miyahara, Nobuaki Fujii, Utako Taniguchi, Akihiko Oda, Naohiro Senoo, Satoru Kataoka, Mikio Tanimoto, Mitsune Kakuta, Hiroki Kiura, Katsuyuki Maeda, Yoshinobu Kanehiro, Arihiko Respir Res Research BACKGROUND: Retinoid X receptors (RXRs) are members of the nuclear receptor (NR) superfamily that mediate signalling by 9-cis retinoic acid, a vitamin A derivative. RXRs play key roles not only as homodimers but also as heterodimeric partners, e.g., for retinoic acid receptors, vitamin D receptors, and peroxisome proliferator-activated receptors. The NR family may also play important roles in the development of emphysema. However, the role of RXRs in the pathogenesis of emphysema is not well defined. METHODS: We developed a novel RXR partial agonist (NEt-4IB) and investigated its effect and mechanism compared to a full agonist (bexarotene) in a murine model of emphysema. For emphysema induction, BALB/c mice received intraperitoneal cigarette smoke extract (CSE) or intratracheal porcine pancreas elastase (PPE). Treatment with RXR agonists was initiated before or after emphysema induction. RESULTS: Treatment with NEt-4IB significantly suppressed the increase in static lung compliance and emphysematous changes in CSE-induced emphysema and PPE-induced established and progressive emphysema. NEt-4IB significantly suppressed PPE-induced neutrophilic airway inflammation and the levels of keratinocyte chemoattractant (KC), C-X-C motif ligand5 (CXCL5), interferon (IFN)-γ and IL-17. NEt-4IB also improved the matrix metalloproteinase-9 (MMP-9)/tissue inhibitor of metalloproteinase-1 (TIMP-1) imbalance and the reduced anti-oxidant activity in bronchoalveolar lavage (BAL) fluid. NEt-4IB suppressed PPE-induced vascular endothelial growth factor (VEGF) expression in the airway. Treatment with NEt-4IB and bexarotene significantly suppressed the increase in static lung compliance and emphysematous changes. However, adverse effects of RXR agonists, including hypertriglyceridemia and hepatomegaly, were observed in bexarotene-treated mice but not in NEt-4IB-treated mice. CONCLUSION: These data suggest that RXRs play crucial roles in emphysema and airway inflammation, and novel partial RXR agonists could be potential therapeutic strategies for the treatment of PPE- and CSE-induced emphysema. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12931-018-0963-0) contains supplementary material, which is available to authorized users. BioMed Central 2019-01-03 2019 /pmc/articles/PMC6318915/ /pubmed/30606200 http://dx.doi.org/10.1186/s12931-018-0963-0 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research
Morichika, Daisuke
Miyahara, Nobuaki
Fujii, Utako
Taniguchi, Akihiko
Oda, Naohiro
Senoo, Satoru
Kataoka, Mikio
Tanimoto, Mitsune
Kakuta, Hiroki
Kiura, Katsuyuki
Maeda, Yoshinobu
Kanehiro, Arihiko
A retinoid X receptor partial agonist attenuates pulmonary emphysema and airway inflammation
title A retinoid X receptor partial agonist attenuates pulmonary emphysema and airway inflammation
title_full A retinoid X receptor partial agonist attenuates pulmonary emphysema and airway inflammation
title_fullStr A retinoid X receptor partial agonist attenuates pulmonary emphysema and airway inflammation
title_full_unstemmed A retinoid X receptor partial agonist attenuates pulmonary emphysema and airway inflammation
title_short A retinoid X receptor partial agonist attenuates pulmonary emphysema and airway inflammation
title_sort retinoid x receptor partial agonist attenuates pulmonary emphysema and airway inflammation
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6318915/
https://www.ncbi.nlm.nih.gov/pubmed/30606200
http://dx.doi.org/10.1186/s12931-018-0963-0
work_keys_str_mv AT morichikadaisuke aretinoidxreceptorpartialagonistattenuatespulmonaryemphysemaandairwayinflammation
AT miyaharanobuaki aretinoidxreceptorpartialagonistattenuatespulmonaryemphysemaandairwayinflammation
AT fujiiutako aretinoidxreceptorpartialagonistattenuatespulmonaryemphysemaandairwayinflammation
AT taniguchiakihiko aretinoidxreceptorpartialagonistattenuatespulmonaryemphysemaandairwayinflammation
AT odanaohiro aretinoidxreceptorpartialagonistattenuatespulmonaryemphysemaandairwayinflammation
AT senoosatoru aretinoidxreceptorpartialagonistattenuatespulmonaryemphysemaandairwayinflammation
AT kataokamikio aretinoidxreceptorpartialagonistattenuatespulmonaryemphysemaandairwayinflammation
AT tanimotomitsune aretinoidxreceptorpartialagonistattenuatespulmonaryemphysemaandairwayinflammation
AT kakutahiroki aretinoidxreceptorpartialagonistattenuatespulmonaryemphysemaandairwayinflammation
AT kiurakatsuyuki aretinoidxreceptorpartialagonistattenuatespulmonaryemphysemaandairwayinflammation
AT maedayoshinobu aretinoidxreceptorpartialagonistattenuatespulmonaryemphysemaandairwayinflammation
AT kanehiroarihiko aretinoidxreceptorpartialagonistattenuatespulmonaryemphysemaandairwayinflammation
AT morichikadaisuke retinoidxreceptorpartialagonistattenuatespulmonaryemphysemaandairwayinflammation
AT miyaharanobuaki retinoidxreceptorpartialagonistattenuatespulmonaryemphysemaandairwayinflammation
AT fujiiutako retinoidxreceptorpartialagonistattenuatespulmonaryemphysemaandairwayinflammation
AT taniguchiakihiko retinoidxreceptorpartialagonistattenuatespulmonaryemphysemaandairwayinflammation
AT odanaohiro retinoidxreceptorpartialagonistattenuatespulmonaryemphysemaandairwayinflammation
AT senoosatoru retinoidxreceptorpartialagonistattenuatespulmonaryemphysemaandairwayinflammation
AT kataokamikio retinoidxreceptorpartialagonistattenuatespulmonaryemphysemaandairwayinflammation
AT tanimotomitsune retinoidxreceptorpartialagonistattenuatespulmonaryemphysemaandairwayinflammation
AT kakutahiroki retinoidxreceptorpartialagonistattenuatespulmonaryemphysemaandairwayinflammation
AT kiurakatsuyuki retinoidxreceptorpartialagonistattenuatespulmonaryemphysemaandairwayinflammation
AT maedayoshinobu retinoidxreceptorpartialagonistattenuatespulmonaryemphysemaandairwayinflammation
AT kanehiroarihiko retinoidxreceptorpartialagonistattenuatespulmonaryemphysemaandairwayinflammation