Cargando…
Modified Buzhong Yiqi decoction for myasthenia gravis: A systematic review protocol
BACKGROUND: Myasthenia gravis (MG) is an autoimmune disease caused by the transmission of dysfunction in the neuromuscular junction, manifesting partial or systemic skeletal muscle weakness and fatigue, which are exacerbated by activities and relieved after rest. Currently, the conventional therapy...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Wolters Kluwer Health
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6320065/ https://www.ncbi.nlm.nih.gov/pubmed/30558075 http://dx.doi.org/10.1097/MD.0000000000013677 |
_version_ | 1783385162667524096 |
---|---|
author | Jiang, Xiaotao Chen, Guoming Huang, Jiahua Xie, Linling Shen, Danting Jiang, Kailin Xu, Hua |
author_facet | Jiang, Xiaotao Chen, Guoming Huang, Jiahua Xie, Linling Shen, Danting Jiang, Kailin Xu, Hua |
author_sort | Jiang, Xiaotao |
collection | PubMed |
description | BACKGROUND: Myasthenia gravis (MG) is an autoimmune disease caused by the transmission of dysfunction in the neuromuscular junction, manifesting partial or systemic skeletal muscle weakness and fatigue, which are exacerbated by activities and relieved after rest. Currently, the conventional therapy is applying cholinesterase inhibitors, steroids, immunosuppressant, and thymectomy. However, these drugs have obvious side effects. According to traditional Chinese medicine (TCM) theory, Buzhong Yiqi decoction (BYD) is a Qi-supplementing formula which is suitable for MG management as MG is generally diagnosed as “flaccidity syndrome” and considered caused by Qi-deficiency. An increasing number of clinical controlled studies also have found that BYD could improve the efficacy and reduced adverse effects in treating MG, but there is no systematic review of it. Therefore, we will use meta-analysis to evaluate the efficacy and safety of BYD for MG. METHODS: PubMed, MEDLINE, EMBASE, Cochrane Library, China National Knowledge Infrastructure (CNKI), Wanfang data, Chinese Scientific Journals Database (VIP), and China biomedical literature database (CBM) will be searched to obtain the eligible studies published up to June 1, 2018. The primary outcome will be clinical absolute score before and after treatment, clinical relative score as well as effective rate. The secondary outcome will be the concentration of acetylcholine receptor antibody (AchRAb) in serum and adverse events incidence. Data analysis will be conducted using RevMan5.3 and Stata V.9.0 software. Trial sequential analysis (TSA) will be performed to assess the risk of random error and the validity of conclusion using TSA program version 0.9 beta. RESULTS: This systematic review will provide a high-quality synthesis of BYD and its modified forms for MG from various evaluation aspects including clinical absolute score before and after treatment, clinical relative score, effective rate, the concentration of AchRAb in serum and adverse events incidence. CONCLUSION: The systematic review will provide evidence to assess the efficacy and safety of BYD and its modified forms in the treatment of MG. PROSPERO REGISTRATION NUMBER: PROSPERO CRD42018095241. |
format | Online Article Text |
id | pubmed-6320065 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | Wolters Kluwer Health |
record_format | MEDLINE/PubMed |
spelling | pubmed-63200652019-01-14 Modified Buzhong Yiqi decoction for myasthenia gravis: A systematic review protocol Jiang, Xiaotao Chen, Guoming Huang, Jiahua Xie, Linling Shen, Danting Jiang, Kailin Xu, Hua Medicine (Baltimore) Research Article BACKGROUND: Myasthenia gravis (MG) is an autoimmune disease caused by the transmission of dysfunction in the neuromuscular junction, manifesting partial or systemic skeletal muscle weakness and fatigue, which are exacerbated by activities and relieved after rest. Currently, the conventional therapy is applying cholinesterase inhibitors, steroids, immunosuppressant, and thymectomy. However, these drugs have obvious side effects. According to traditional Chinese medicine (TCM) theory, Buzhong Yiqi decoction (BYD) is a Qi-supplementing formula which is suitable for MG management as MG is generally diagnosed as “flaccidity syndrome” and considered caused by Qi-deficiency. An increasing number of clinical controlled studies also have found that BYD could improve the efficacy and reduced adverse effects in treating MG, but there is no systematic review of it. Therefore, we will use meta-analysis to evaluate the efficacy and safety of BYD for MG. METHODS: PubMed, MEDLINE, EMBASE, Cochrane Library, China National Knowledge Infrastructure (CNKI), Wanfang data, Chinese Scientific Journals Database (VIP), and China biomedical literature database (CBM) will be searched to obtain the eligible studies published up to June 1, 2018. The primary outcome will be clinical absolute score before and after treatment, clinical relative score as well as effective rate. The secondary outcome will be the concentration of acetylcholine receptor antibody (AchRAb) in serum and adverse events incidence. Data analysis will be conducted using RevMan5.3 and Stata V.9.0 software. Trial sequential analysis (TSA) will be performed to assess the risk of random error and the validity of conclusion using TSA program version 0.9 beta. RESULTS: This systematic review will provide a high-quality synthesis of BYD and its modified forms for MG from various evaluation aspects including clinical absolute score before and after treatment, clinical relative score, effective rate, the concentration of AchRAb in serum and adverse events incidence. CONCLUSION: The systematic review will provide evidence to assess the efficacy and safety of BYD and its modified forms in the treatment of MG. PROSPERO REGISTRATION NUMBER: PROSPERO CRD42018095241. Wolters Kluwer Health 2018-12-14 /pmc/articles/PMC6320065/ /pubmed/30558075 http://dx.doi.org/10.1097/MD.0000000000013677 Text en Copyright © 2018 the Author(s). Published by Wolters Kluwer Health, Inc. http://creativecommons.org/licenses/by/4.0 This is an open access article distributed under the Creative Commons Attribution License 4.0 (CCBY), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. http://creativecommons.org/licenses/by/4.0 |
spellingShingle | Research Article Jiang, Xiaotao Chen, Guoming Huang, Jiahua Xie, Linling Shen, Danting Jiang, Kailin Xu, Hua Modified Buzhong Yiqi decoction for myasthenia gravis: A systematic review protocol |
title | Modified Buzhong Yiqi decoction for myasthenia gravis: A systematic review protocol |
title_full | Modified Buzhong Yiqi decoction for myasthenia gravis: A systematic review protocol |
title_fullStr | Modified Buzhong Yiqi decoction for myasthenia gravis: A systematic review protocol |
title_full_unstemmed | Modified Buzhong Yiqi decoction for myasthenia gravis: A systematic review protocol |
title_short | Modified Buzhong Yiqi decoction for myasthenia gravis: A systematic review protocol |
title_sort | modified buzhong yiqi decoction for myasthenia gravis: a systematic review protocol |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6320065/ https://www.ncbi.nlm.nih.gov/pubmed/30558075 http://dx.doi.org/10.1097/MD.0000000000013677 |
work_keys_str_mv | AT jiangxiaotao modifiedbuzhongyiqidecoctionformyastheniagravisasystematicreviewprotocol AT chenguoming modifiedbuzhongyiqidecoctionformyastheniagravisasystematicreviewprotocol AT huangjiahua modifiedbuzhongyiqidecoctionformyastheniagravisasystematicreviewprotocol AT xielinling modifiedbuzhongyiqidecoctionformyastheniagravisasystematicreviewprotocol AT shendanting modifiedbuzhongyiqidecoctionformyastheniagravisasystematicreviewprotocol AT jiangkailin modifiedbuzhongyiqidecoctionformyastheniagravisasystematicreviewprotocol AT xuhua modifiedbuzhongyiqidecoctionformyastheniagravisasystematicreviewprotocol |