Cargando…
Determinants of access to HIV testing and counselling services among female sex workers in sub-Saharan Africa: a systematic review
BACKGROUND: HIV testing and counselling (HTC) is an essential component for HIV prevention and a critical entry point into the HIV continuum of care and treatment. Despite the importance of HTC for HIV control, access to HTC services among female sex workers (FSWs) in sub-Saharan Africa (SSA) remain...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6321716/ https://www.ncbi.nlm.nih.gov/pubmed/30611219 http://dx.doi.org/10.1186/s12889-018-6362-0 |
_version_ | 1783385508373594112 |
---|---|
author | Nnko, Soori Kuringe, Evodius Nyato, Daniel Drake, Mary Casalini, Caterina Shao, Amani Komba, Albert Baral, Stefan Wambura, Mwita Changalucha, John |
author_facet | Nnko, Soori Kuringe, Evodius Nyato, Daniel Drake, Mary Casalini, Caterina Shao, Amani Komba, Albert Baral, Stefan Wambura, Mwita Changalucha, John |
author_sort | Nnko, Soori |
collection | PubMed |
description | BACKGROUND: HIV testing and counselling (HTC) is an essential component for HIV prevention and a critical entry point into the HIV continuum of care and treatment. Despite the importance of HTC for HIV control, access to HTC services among female sex workers (FSWs) in sub-Saharan Africa (SSA) remains suboptimal and little is known about factors influencing FSWs’ access to HTC. Guided by the client-centred conceptual framework, we conducted a systematic review to understand the facilitators and barriers influencing FSWs in SSA to access HTC services. METHODS: A systematic search was conducted in MEDLINE, POPLINE and Web of Science databases for literature published between January 2000 and July 2017. References of relevant articles were also searched. We included primary studies of any design, conducted in SSA and published in the English language. Studies conducted in multi-sites inclusive of SSA were included only if data from sites in SSA were separately analysed and reported. Similarly, studies that included other subpopulations were only eligible if a separate analysis was done for FSWs. This review excluded papers published as systematic reviews, editorial comments and mathematical modelling. The protocol for this review is registered in the Prospective Register of Systematic Reviews (PROSPERO), registration number CRD42017062203. RESULTS: This review shows that factors related to approachability, acceptability, availability, affordability and appropriateness of the services are crucial in influencing access to HTC services among FSWs in SSA. These factors were mediated by individual attributes such as HIV risk perceptions, awareness of the availability of HTC, and perceptions of the importance and quality of HTC services. The decision to utilise HTC was predominantly hampered by discriminatory social norms such as HIV stigma and criminalisation of sex work. CONCLUSIONS: FSWs’ access to HTC is facilitated by multiple factors, including individual awareness of the availability of HTC services, and perceived quality of HTC especially with regard to assured confidentiality. Concerns about HIV stigma and fear about discrimination due to community intolerance of sex work acted as major barriers for FSWs to seek HTC services from the facilities offering health services to the general population. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12889-018-6362-0) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-6321716 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-63217162019-01-09 Determinants of access to HIV testing and counselling services among female sex workers in sub-Saharan Africa: a systematic review Nnko, Soori Kuringe, Evodius Nyato, Daniel Drake, Mary Casalini, Caterina Shao, Amani Komba, Albert Baral, Stefan Wambura, Mwita Changalucha, John BMC Public Health Research Article BACKGROUND: HIV testing and counselling (HTC) is an essential component for HIV prevention and a critical entry point into the HIV continuum of care and treatment. Despite the importance of HTC for HIV control, access to HTC services among female sex workers (FSWs) in sub-Saharan Africa (SSA) remains suboptimal and little is known about factors influencing FSWs’ access to HTC. Guided by the client-centred conceptual framework, we conducted a systematic review to understand the facilitators and barriers influencing FSWs in SSA to access HTC services. METHODS: A systematic search was conducted in MEDLINE, POPLINE and Web of Science databases for literature published between January 2000 and July 2017. References of relevant articles were also searched. We included primary studies of any design, conducted in SSA and published in the English language. Studies conducted in multi-sites inclusive of SSA were included only if data from sites in SSA were separately analysed and reported. Similarly, studies that included other subpopulations were only eligible if a separate analysis was done for FSWs. This review excluded papers published as systematic reviews, editorial comments and mathematical modelling. The protocol for this review is registered in the Prospective Register of Systematic Reviews (PROSPERO), registration number CRD42017062203. RESULTS: This review shows that factors related to approachability, acceptability, availability, affordability and appropriateness of the services are crucial in influencing access to HTC services among FSWs in SSA. These factors were mediated by individual attributes such as HIV risk perceptions, awareness of the availability of HTC, and perceptions of the importance and quality of HTC services. The decision to utilise HTC was predominantly hampered by discriminatory social norms such as HIV stigma and criminalisation of sex work. CONCLUSIONS: FSWs’ access to HTC is facilitated by multiple factors, including individual awareness of the availability of HTC services, and perceived quality of HTC especially with regard to assured confidentiality. Concerns about HIV stigma and fear about discrimination due to community intolerance of sex work acted as major barriers for FSWs to seek HTC services from the facilities offering health services to the general population. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12889-018-6362-0) contains supplementary material, which is available to authorized users. BioMed Central 2019-01-05 /pmc/articles/PMC6321716/ /pubmed/30611219 http://dx.doi.org/10.1186/s12889-018-6362-0 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Nnko, Soori Kuringe, Evodius Nyato, Daniel Drake, Mary Casalini, Caterina Shao, Amani Komba, Albert Baral, Stefan Wambura, Mwita Changalucha, John Determinants of access to HIV testing and counselling services among female sex workers in sub-Saharan Africa: a systematic review |
title | Determinants of access to HIV testing and counselling services among female sex workers in sub-Saharan Africa: a systematic review |
title_full | Determinants of access to HIV testing and counselling services among female sex workers in sub-Saharan Africa: a systematic review |
title_fullStr | Determinants of access to HIV testing and counselling services among female sex workers in sub-Saharan Africa: a systematic review |
title_full_unstemmed | Determinants of access to HIV testing and counselling services among female sex workers in sub-Saharan Africa: a systematic review |
title_short | Determinants of access to HIV testing and counselling services among female sex workers in sub-Saharan Africa: a systematic review |
title_sort | determinants of access to hiv testing and counselling services among female sex workers in sub-saharan africa: a systematic review |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6321716/ https://www.ncbi.nlm.nih.gov/pubmed/30611219 http://dx.doi.org/10.1186/s12889-018-6362-0 |
work_keys_str_mv | AT nnkosoori determinantsofaccesstohivtestingandcounsellingservicesamongfemalesexworkersinsubsaharanafricaasystematicreview AT kuringeevodius determinantsofaccesstohivtestingandcounsellingservicesamongfemalesexworkersinsubsaharanafricaasystematicreview AT nyatodaniel determinantsofaccesstohivtestingandcounsellingservicesamongfemalesexworkersinsubsaharanafricaasystematicreview AT drakemary determinantsofaccesstohivtestingandcounsellingservicesamongfemalesexworkersinsubsaharanafricaasystematicreview AT casalinicaterina determinantsofaccesstohivtestingandcounsellingservicesamongfemalesexworkersinsubsaharanafricaasystematicreview AT shaoamani determinantsofaccesstohivtestingandcounsellingservicesamongfemalesexworkersinsubsaharanafricaasystematicreview AT kombaalbert determinantsofaccesstohivtestingandcounsellingservicesamongfemalesexworkersinsubsaharanafricaasystematicreview AT baralstefan determinantsofaccesstohivtestingandcounsellingservicesamongfemalesexworkersinsubsaharanafricaasystematicreview AT wamburamwita determinantsofaccesstohivtestingandcounsellingservicesamongfemalesexworkersinsubsaharanafricaasystematicreview AT changaluchajohn determinantsofaccesstohivtestingandcounsellingservicesamongfemalesexworkersinsubsaharanafricaasystematicreview |