Cargando…
Immunological Homeostasis at the Ovine Placenta May Reflect the Degree of Maternal Fetal Interaction
Successful mammalian pregnancies are a result of complex physiological, endocrinological, and immunological processes that combine to create an environment where the mother is tolerant to the semi-allogeneic fetus. Our knowledge of the mechanisms that contribute to maternal tolerance is derived main...
Autores principales: | , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6334339/ https://www.ncbi.nlm.nih.gov/pubmed/30687304 http://dx.doi.org/10.3389/fimmu.2018.03025 |
_version_ | 1783387691391385600 |
---|---|
author | Wattegedera, Sean R. Doull, Laura E. Goncheva, Mariya I. Wheelhouse, Nicholas M. Watson, Donna M. Pearce, Julian Benavides, Julio Palarea-Albaladejo, Javier McInnes, Colin J. Ballingall, Keith Entrican, Gary |
author_facet | Wattegedera, Sean R. Doull, Laura E. Goncheva, Mariya I. Wheelhouse, Nicholas M. Watson, Donna M. Pearce, Julian Benavides, Julio Palarea-Albaladejo, Javier McInnes, Colin J. Ballingall, Keith Entrican, Gary |
author_sort | Wattegedera, Sean R. |
collection | PubMed |
description | Successful mammalian pregnancies are a result of complex physiological, endocrinological, and immunological processes that combine to create an environment where the mother is tolerant to the semi-allogeneic fetus. Our knowledge of the mechanisms that contribute to maternal tolerance is derived mainly from human and murine studies of haemochorial placentation. However, as this is the most invasive type of placentation it cannot be assumed that identical mechanisms apply to the less invasive epitheliochorial placentation found in other species such as ruminants. Here, we examine three features associated with reproductive immune regulation in a transformed ovine trophoblast cell line and ex-vivo ovine reproductive tissues collected at term, namely: major histocompatibility complex (MHC) expression, Indoleamine 2,3 dioxygenase-1 (IDO-1) expression, and Natural Killer (NK) cell infiltration. High levels of MHC class I protein expression were detected at the surface of the trophoblast cell line using a pan-MHC class I specific monoclonal antibody. The majority of MHC class I transcripts isolated from the cell line clustered with classical MHC alleles. Transcriptional analysis of placental tissues identified only classical MHC class I transcripts. We found no evidence of constitutive transcription of IDO-1 in either the trophoblast cell line or placental tissues. Ex-vivo tissues collected from the materno-fetal interface were negative for cells expressing NKp46/NCR1. Collectively, these observations suggest that the relatively non-invasive synepitheliochorial placentation found in sheep has a more limited requirement for local immunoregulation compared to the more invasive haemochorial placentation of primates and rodents. |
format | Online Article Text |
id | pubmed-6334339 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-63343392019-01-25 Immunological Homeostasis at the Ovine Placenta May Reflect the Degree of Maternal Fetal Interaction Wattegedera, Sean R. Doull, Laura E. Goncheva, Mariya I. Wheelhouse, Nicholas M. Watson, Donna M. Pearce, Julian Benavides, Julio Palarea-Albaladejo, Javier McInnes, Colin J. Ballingall, Keith Entrican, Gary Front Immunol Immunology Successful mammalian pregnancies are a result of complex physiological, endocrinological, and immunological processes that combine to create an environment where the mother is tolerant to the semi-allogeneic fetus. Our knowledge of the mechanisms that contribute to maternal tolerance is derived mainly from human and murine studies of haemochorial placentation. However, as this is the most invasive type of placentation it cannot be assumed that identical mechanisms apply to the less invasive epitheliochorial placentation found in other species such as ruminants. Here, we examine three features associated with reproductive immune regulation in a transformed ovine trophoblast cell line and ex-vivo ovine reproductive tissues collected at term, namely: major histocompatibility complex (MHC) expression, Indoleamine 2,3 dioxygenase-1 (IDO-1) expression, and Natural Killer (NK) cell infiltration. High levels of MHC class I protein expression were detected at the surface of the trophoblast cell line using a pan-MHC class I specific monoclonal antibody. The majority of MHC class I transcripts isolated from the cell line clustered with classical MHC alleles. Transcriptional analysis of placental tissues identified only classical MHC class I transcripts. We found no evidence of constitutive transcription of IDO-1 in either the trophoblast cell line or placental tissues. Ex-vivo tissues collected from the materno-fetal interface were negative for cells expressing NKp46/NCR1. Collectively, these observations suggest that the relatively non-invasive synepitheliochorial placentation found in sheep has a more limited requirement for local immunoregulation compared to the more invasive haemochorial placentation of primates and rodents. Frontiers Media S.A. 2019-01-09 /pmc/articles/PMC6334339/ /pubmed/30687304 http://dx.doi.org/10.3389/fimmu.2018.03025 Text en Copyright © 2019 Wattegedera, Doull, Goncheva, Wheelhouse, Watson, Pearce, Benavides, Palarea-Albaladejo, McInnes, Ballingall and Entrican. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Immunology Wattegedera, Sean R. Doull, Laura E. Goncheva, Mariya I. Wheelhouse, Nicholas M. Watson, Donna M. Pearce, Julian Benavides, Julio Palarea-Albaladejo, Javier McInnes, Colin J. Ballingall, Keith Entrican, Gary Immunological Homeostasis at the Ovine Placenta May Reflect the Degree of Maternal Fetal Interaction |
title | Immunological Homeostasis at the Ovine Placenta May Reflect the Degree of Maternal Fetal Interaction |
title_full | Immunological Homeostasis at the Ovine Placenta May Reflect the Degree of Maternal Fetal Interaction |
title_fullStr | Immunological Homeostasis at the Ovine Placenta May Reflect the Degree of Maternal Fetal Interaction |
title_full_unstemmed | Immunological Homeostasis at the Ovine Placenta May Reflect the Degree of Maternal Fetal Interaction |
title_short | Immunological Homeostasis at the Ovine Placenta May Reflect the Degree of Maternal Fetal Interaction |
title_sort | immunological homeostasis at the ovine placenta may reflect the degree of maternal fetal interaction |
topic | Immunology |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6334339/ https://www.ncbi.nlm.nih.gov/pubmed/30687304 http://dx.doi.org/10.3389/fimmu.2018.03025 |
work_keys_str_mv | AT wattegederaseanr immunologicalhomeostasisattheovineplacentamayreflectthedegreeofmaternalfetalinteraction AT doulllaurae immunologicalhomeostasisattheovineplacentamayreflectthedegreeofmaternalfetalinteraction AT gonchevamariyai immunologicalhomeostasisattheovineplacentamayreflectthedegreeofmaternalfetalinteraction AT wheelhousenicholasm immunologicalhomeostasisattheovineplacentamayreflectthedegreeofmaternalfetalinteraction AT watsondonnam immunologicalhomeostasisattheovineplacentamayreflectthedegreeofmaternalfetalinteraction AT pearcejulian immunologicalhomeostasisattheovineplacentamayreflectthedegreeofmaternalfetalinteraction AT benavidesjulio immunologicalhomeostasisattheovineplacentamayreflectthedegreeofmaternalfetalinteraction AT palareaalbaladejojavier immunologicalhomeostasisattheovineplacentamayreflectthedegreeofmaternalfetalinteraction AT mcinnescolinj immunologicalhomeostasisattheovineplacentamayreflectthedegreeofmaternalfetalinteraction AT ballingallkeith immunologicalhomeostasisattheovineplacentamayreflectthedegreeofmaternalfetalinteraction AT entricangary immunologicalhomeostasisattheovineplacentamayreflectthedegreeofmaternalfetalinteraction |