Cargando…

In Vitro Immune-Enhancing Activity of Ovotransferrin from Egg White via MAPK Signaling Pathways in RAW 264.7 Macrophages

Ovotransferrin (OTF) is a well-known protein of the transferrin family with strong iron chelating activity, resulting in its antimicrobial activity. Furthermore, OTF is known to have antioxidant, anticancer, and antihypertensive activities. However, there have been few studies about the immune-enhan...

Descripción completa

Detalles Bibliográficos
Autores principales: Lee, Jae Hoon, Ahn, Dong Uk, Paik, Hyun-Dong
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Korean Society for Food Science of Animal Resources 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6335134/
https://www.ncbi.nlm.nih.gov/pubmed/30675115
http://dx.doi.org/10.5851/kosfa.2018.e56
_version_ 1783387841860993024
author Lee, Jae Hoon
Ahn, Dong Uk
Paik, Hyun-Dong
author_facet Lee, Jae Hoon
Ahn, Dong Uk
Paik, Hyun-Dong
author_sort Lee, Jae Hoon
collection PubMed
description Ovotransferrin (OTF) is a well-known protein of the transferrin family with strong iron chelating activity, resulting in its antimicrobial activity. Furthermore, OTF is known to have antioxidant, anticancer, and antihypertensive activities. However, there have been few studies about the immune-enhancing activity of OTF. In current study, we investigated the immune-enhancing activity of OTF using the murine macrophage cells in vitro. The effect of OTF on production of pro-inflammatory mediators and cytokines were determined using Griess assay and quantitative real-time PCR. Using Neutral Red uptake assay, we confirmed the effect of OTF on phagocytic activity of macrophages. Ovotransferrin significantly increased the production of nitric oxide (NO) and secretion of inducible nitric oxide synthase (iNOS) mRNA with no cytotoxic activity. Ovotransferrin (2 mg/mL) stimulated NO production up to 31.9±3.5 μM. Ovotransferrin significantly increased the mRNA expression levels of pro-inflammatory cytokines which are tumor necrosis factor-α (TNF-α), Interleukin-1β (IL-1β), and IL-6: OTF (2 mg/mL) treatment increased the secretion of mRNA for TNF-α, IL-1β, and IL-6 by 22.20-, 37.91-, and 6.17-fold of the negative control, respectively. The phagocytic activity of macrophages was also increased by OTF treatment significantly compared with negative control. Also, OTF treatment increased phosphorylation level of MAPK signaling pathways. These results indicated that OTF has immune-enhancing activity by activating RAW 264.7 macrophages via MAPK pathways.
format Online
Article
Text
id pubmed-6335134
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher Korean Society for Food Science of Animal Resources
record_format MEDLINE/PubMed
spelling pubmed-63351342019-01-23 In Vitro Immune-Enhancing Activity of Ovotransferrin from Egg White via MAPK Signaling Pathways in RAW 264.7 Macrophages Lee, Jae Hoon Ahn, Dong Uk Paik, Hyun-Dong Korean J Food Sci Anim Resour Article Ovotransferrin (OTF) is a well-known protein of the transferrin family with strong iron chelating activity, resulting in its antimicrobial activity. Furthermore, OTF is known to have antioxidant, anticancer, and antihypertensive activities. However, there have been few studies about the immune-enhancing activity of OTF. In current study, we investigated the immune-enhancing activity of OTF using the murine macrophage cells in vitro. The effect of OTF on production of pro-inflammatory mediators and cytokines were determined using Griess assay and quantitative real-time PCR. Using Neutral Red uptake assay, we confirmed the effect of OTF on phagocytic activity of macrophages. Ovotransferrin significantly increased the production of nitric oxide (NO) and secretion of inducible nitric oxide synthase (iNOS) mRNA with no cytotoxic activity. Ovotransferrin (2 mg/mL) stimulated NO production up to 31.9±3.5 μM. Ovotransferrin significantly increased the mRNA expression levels of pro-inflammatory cytokines which are tumor necrosis factor-α (TNF-α), Interleukin-1β (IL-1β), and IL-6: OTF (2 mg/mL) treatment increased the secretion of mRNA for TNF-α, IL-1β, and IL-6 by 22.20-, 37.91-, and 6.17-fold of the negative control, respectively. The phagocytic activity of macrophages was also increased by OTF treatment significantly compared with negative control. Also, OTF treatment increased phosphorylation level of MAPK signaling pathways. These results indicated that OTF has immune-enhancing activity by activating RAW 264.7 macrophages via MAPK pathways. Korean Society for Food Science of Animal Resources 2018-12 2018-12-31 /pmc/articles/PMC6335134/ /pubmed/30675115 http://dx.doi.org/10.5851/kosfa.2018.e56 Text en © Copyright 2018 Korean Society for Food Science of Animal Resources http://creativecommons.org/licenses/by-nc/3.0/ This is an Open-Access article distributed under the terms of the Creative Commons Attribution Non-Commercial License (http://creativecommons.org/licenses/by-nc/3.0) which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Article
Lee, Jae Hoon
Ahn, Dong Uk
Paik, Hyun-Dong
In Vitro Immune-Enhancing Activity of Ovotransferrin from Egg White via MAPK Signaling Pathways in RAW 264.7 Macrophages
title In Vitro Immune-Enhancing Activity of Ovotransferrin from Egg White via MAPK Signaling Pathways in RAW 264.7 Macrophages
title_full In Vitro Immune-Enhancing Activity of Ovotransferrin from Egg White via MAPK Signaling Pathways in RAW 264.7 Macrophages
title_fullStr In Vitro Immune-Enhancing Activity of Ovotransferrin from Egg White via MAPK Signaling Pathways in RAW 264.7 Macrophages
title_full_unstemmed In Vitro Immune-Enhancing Activity of Ovotransferrin from Egg White via MAPK Signaling Pathways in RAW 264.7 Macrophages
title_short In Vitro Immune-Enhancing Activity of Ovotransferrin from Egg White via MAPK Signaling Pathways in RAW 264.7 Macrophages
title_sort in vitro immune-enhancing activity of ovotransferrin from egg white via mapk signaling pathways in raw 264.7 macrophages
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6335134/
https://www.ncbi.nlm.nih.gov/pubmed/30675115
http://dx.doi.org/10.5851/kosfa.2018.e56
work_keys_str_mv AT leejaehoon invitroimmuneenhancingactivityofovotransferrinfromeggwhiteviamapksignalingpathwaysinraw2647macrophages
AT ahndonguk invitroimmuneenhancingactivityofovotransferrinfromeggwhiteviamapksignalingpathwaysinraw2647macrophages
AT paikhyundong invitroimmuneenhancingactivityofovotransferrinfromeggwhiteviamapksignalingpathwaysinraw2647macrophages