Cargando…

Effectiveness of Screening and Treatment Approaches for Schistosomiasis and Strongyloidiasis in Newly-Arrived Migrants from Endemic Countries in the EU/EEA: A Systematic Review

We aimed to evaluate the evidence on screening and treatment for two parasitic infections—schistosomiasis and strongyloidiasis—among migrants from endemic countries arriving in the European Union and European Economic Area (EU/EEA). We conducted a systematic search of multiple databases to identify...

Descripción completa

Detalles Bibliográficos
Autores principales: Agbata, Eric N., Morton, Rachael L., Bisoffi, Zeno, Bottieau, Emmanuel, Greenaway, Christina, Biggs, Beverley-A., Montero, Nadia, Tran, Anh, Rowbotham, Nick, Arevalo-Rodriguez, Ingrid, Myran, Daniel T., Noori, Teymur, Alonso-Coello, Pablo, Pottie, Kevin, Requena-Méndez, Ana
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6339107/
https://www.ncbi.nlm.nih.gov/pubmed/30577567
http://dx.doi.org/10.3390/ijerph16010011
_version_ 1783388561940152320
author Agbata, Eric N.
Morton, Rachael L.
Bisoffi, Zeno
Bottieau, Emmanuel
Greenaway, Christina
Biggs, Beverley-A.
Montero, Nadia
Tran, Anh
Rowbotham, Nick
Arevalo-Rodriguez, Ingrid
Myran, Daniel T.
Noori, Teymur
Alonso-Coello, Pablo
Pottie, Kevin
Requena-Méndez, Ana
author_facet Agbata, Eric N.
Morton, Rachael L.
Bisoffi, Zeno
Bottieau, Emmanuel
Greenaway, Christina
Biggs, Beverley-A.
Montero, Nadia
Tran, Anh
Rowbotham, Nick
Arevalo-Rodriguez, Ingrid
Myran, Daniel T.
Noori, Teymur
Alonso-Coello, Pablo
Pottie, Kevin
Requena-Méndez, Ana
author_sort Agbata, Eric N.
collection PubMed
description We aimed to evaluate the evidence on screening and treatment for two parasitic infections—schistosomiasis and strongyloidiasis—among migrants from endemic countries arriving in the European Union and European Economic Area (EU/EEA). We conducted a systematic search of multiple databases to identify systematic reviews and meta-analyses published between 1 January 1993 and 30 May 2016 presenting evidence on diagnostic and treatment efficacy and cost-effectiveness. We conducted additional systematic search for individual studies published between 2010 and 2017. We assessed the methodological quality of reviews and studies using the AMSTAR, Newcastle–Ottawa Scale and QUADAS-II tools. Study synthesis and assessment of the certainty of the evidence was performed using GRADE (Grading of Recommendations Assessment, Development and Evaluation) approach. We included 28 systematic reviews and individual studies in this review. The GRADE certainty of evidence was low for the effectiveness of screening techniques and moderate to high for treatment efficacy. Antibody-detecting serological tests are the most effective screening tests for detection of both schistosomiasis and strongyloidiasis in low-endemicity settings, because they have higher sensitivity than conventional parasitological methods. Short courses of praziquantel and ivermectin were safe and highly effective and cost-effective in treating schistosomiasis and strongyloidiasis, respectively. Economic modelling suggests presumptive single-dose treatment of strongyloidiasis with ivermectin for all migrants is likely cost-effective, but feasibility of this strategy has yet to be demonstrated in clinical studies. The evidence supports screening and treatment for schistosomiasis and strongyloidiasis in migrants from endemic countries, to reduce morbidity and mortality.
format Online
Article
Text
id pubmed-6339107
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-63391072019-01-23 Effectiveness of Screening and Treatment Approaches for Schistosomiasis and Strongyloidiasis in Newly-Arrived Migrants from Endemic Countries in the EU/EEA: A Systematic Review Agbata, Eric N. Morton, Rachael L. Bisoffi, Zeno Bottieau, Emmanuel Greenaway, Christina Biggs, Beverley-A. Montero, Nadia Tran, Anh Rowbotham, Nick Arevalo-Rodriguez, Ingrid Myran, Daniel T. Noori, Teymur Alonso-Coello, Pablo Pottie, Kevin Requena-Méndez, Ana Int J Environ Res Public Health Review We aimed to evaluate the evidence on screening and treatment for two parasitic infections—schistosomiasis and strongyloidiasis—among migrants from endemic countries arriving in the European Union and European Economic Area (EU/EEA). We conducted a systematic search of multiple databases to identify systematic reviews and meta-analyses published between 1 January 1993 and 30 May 2016 presenting evidence on diagnostic and treatment efficacy and cost-effectiveness. We conducted additional systematic search for individual studies published between 2010 and 2017. We assessed the methodological quality of reviews and studies using the AMSTAR, Newcastle–Ottawa Scale and QUADAS-II tools. Study synthesis and assessment of the certainty of the evidence was performed using GRADE (Grading of Recommendations Assessment, Development and Evaluation) approach. We included 28 systematic reviews and individual studies in this review. The GRADE certainty of evidence was low for the effectiveness of screening techniques and moderate to high for treatment efficacy. Antibody-detecting serological tests are the most effective screening tests for detection of both schistosomiasis and strongyloidiasis in low-endemicity settings, because they have higher sensitivity than conventional parasitological methods. Short courses of praziquantel and ivermectin were safe and highly effective and cost-effective in treating schistosomiasis and strongyloidiasis, respectively. Economic modelling suggests presumptive single-dose treatment of strongyloidiasis with ivermectin for all migrants is likely cost-effective, but feasibility of this strategy has yet to be demonstrated in clinical studies. The evidence supports screening and treatment for schistosomiasis and strongyloidiasis in migrants from endemic countries, to reduce morbidity and mortality. MDPI 2018-12-20 2019-01 /pmc/articles/PMC6339107/ /pubmed/30577567 http://dx.doi.org/10.3390/ijerph16010011 Text en © 2018 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
spellingShingle Review
Agbata, Eric N.
Morton, Rachael L.
Bisoffi, Zeno
Bottieau, Emmanuel
Greenaway, Christina
Biggs, Beverley-A.
Montero, Nadia
Tran, Anh
Rowbotham, Nick
Arevalo-Rodriguez, Ingrid
Myran, Daniel T.
Noori, Teymur
Alonso-Coello, Pablo
Pottie, Kevin
Requena-Méndez, Ana
Effectiveness of Screening and Treatment Approaches for Schistosomiasis and Strongyloidiasis in Newly-Arrived Migrants from Endemic Countries in the EU/EEA: A Systematic Review
title Effectiveness of Screening and Treatment Approaches for Schistosomiasis and Strongyloidiasis in Newly-Arrived Migrants from Endemic Countries in the EU/EEA: A Systematic Review
title_full Effectiveness of Screening and Treatment Approaches for Schistosomiasis and Strongyloidiasis in Newly-Arrived Migrants from Endemic Countries in the EU/EEA: A Systematic Review
title_fullStr Effectiveness of Screening and Treatment Approaches for Schistosomiasis and Strongyloidiasis in Newly-Arrived Migrants from Endemic Countries in the EU/EEA: A Systematic Review
title_full_unstemmed Effectiveness of Screening and Treatment Approaches for Schistosomiasis and Strongyloidiasis in Newly-Arrived Migrants from Endemic Countries in the EU/EEA: A Systematic Review
title_short Effectiveness of Screening and Treatment Approaches for Schistosomiasis and Strongyloidiasis in Newly-Arrived Migrants from Endemic Countries in the EU/EEA: A Systematic Review
title_sort effectiveness of screening and treatment approaches for schistosomiasis and strongyloidiasis in newly-arrived migrants from endemic countries in the eu/eea: a systematic review
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6339107/
https://www.ncbi.nlm.nih.gov/pubmed/30577567
http://dx.doi.org/10.3390/ijerph16010011
work_keys_str_mv AT agbataericn effectivenessofscreeningandtreatmentapproachesforschistosomiasisandstrongyloidiasisinnewlyarrivedmigrantsfromendemiccountriesintheeueeaasystematicreview
AT mortonrachaell effectivenessofscreeningandtreatmentapproachesforschistosomiasisandstrongyloidiasisinnewlyarrivedmigrantsfromendemiccountriesintheeueeaasystematicreview
AT bisoffizeno effectivenessofscreeningandtreatmentapproachesforschistosomiasisandstrongyloidiasisinnewlyarrivedmigrantsfromendemiccountriesintheeueeaasystematicreview
AT bottieauemmanuel effectivenessofscreeningandtreatmentapproachesforschistosomiasisandstrongyloidiasisinnewlyarrivedmigrantsfromendemiccountriesintheeueeaasystematicreview
AT greenawaychristina effectivenessofscreeningandtreatmentapproachesforschistosomiasisandstrongyloidiasisinnewlyarrivedmigrantsfromendemiccountriesintheeueeaasystematicreview
AT biggsbeverleya effectivenessofscreeningandtreatmentapproachesforschistosomiasisandstrongyloidiasisinnewlyarrivedmigrantsfromendemiccountriesintheeueeaasystematicreview
AT monteronadia effectivenessofscreeningandtreatmentapproachesforschistosomiasisandstrongyloidiasisinnewlyarrivedmigrantsfromendemiccountriesintheeueeaasystematicreview
AT trananh effectivenessofscreeningandtreatmentapproachesforschistosomiasisandstrongyloidiasisinnewlyarrivedmigrantsfromendemiccountriesintheeueeaasystematicreview
AT rowbothamnick effectivenessofscreeningandtreatmentapproachesforschistosomiasisandstrongyloidiasisinnewlyarrivedmigrantsfromendemiccountriesintheeueeaasystematicreview
AT arevalorodriguezingrid effectivenessofscreeningandtreatmentapproachesforschistosomiasisandstrongyloidiasisinnewlyarrivedmigrantsfromendemiccountriesintheeueeaasystematicreview
AT myrandanielt effectivenessofscreeningandtreatmentapproachesforschistosomiasisandstrongyloidiasisinnewlyarrivedmigrantsfromendemiccountriesintheeueeaasystematicreview
AT nooriteymur effectivenessofscreeningandtreatmentapproachesforschistosomiasisandstrongyloidiasisinnewlyarrivedmigrantsfromendemiccountriesintheeueeaasystematicreview
AT alonsocoellopablo effectivenessofscreeningandtreatmentapproachesforschistosomiasisandstrongyloidiasisinnewlyarrivedmigrantsfromendemiccountriesintheeueeaasystematicreview
AT pottiekevin effectivenessofscreeningandtreatmentapproachesforschistosomiasisandstrongyloidiasisinnewlyarrivedmigrantsfromendemiccountriesintheeueeaasystematicreview
AT requenamendezana effectivenessofscreeningandtreatmentapproachesforschistosomiasisandstrongyloidiasisinnewlyarrivedmigrantsfromendemiccountriesintheeueeaasystematicreview