Cargando…
Effectiveness of Screening and Treatment Approaches for Schistosomiasis and Strongyloidiasis in Newly-Arrived Migrants from Endemic Countries in the EU/EEA: A Systematic Review
We aimed to evaluate the evidence on screening and treatment for two parasitic infections—schistosomiasis and strongyloidiasis—among migrants from endemic countries arriving in the European Union and European Economic Area (EU/EEA). We conducted a systematic search of multiple databases to identify...
Autores principales: | , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6339107/ https://www.ncbi.nlm.nih.gov/pubmed/30577567 http://dx.doi.org/10.3390/ijerph16010011 |
_version_ | 1783388561940152320 |
---|---|
author | Agbata, Eric N. Morton, Rachael L. Bisoffi, Zeno Bottieau, Emmanuel Greenaway, Christina Biggs, Beverley-A. Montero, Nadia Tran, Anh Rowbotham, Nick Arevalo-Rodriguez, Ingrid Myran, Daniel T. Noori, Teymur Alonso-Coello, Pablo Pottie, Kevin Requena-Méndez, Ana |
author_facet | Agbata, Eric N. Morton, Rachael L. Bisoffi, Zeno Bottieau, Emmanuel Greenaway, Christina Biggs, Beverley-A. Montero, Nadia Tran, Anh Rowbotham, Nick Arevalo-Rodriguez, Ingrid Myran, Daniel T. Noori, Teymur Alonso-Coello, Pablo Pottie, Kevin Requena-Méndez, Ana |
author_sort | Agbata, Eric N. |
collection | PubMed |
description | We aimed to evaluate the evidence on screening and treatment for two parasitic infections—schistosomiasis and strongyloidiasis—among migrants from endemic countries arriving in the European Union and European Economic Area (EU/EEA). We conducted a systematic search of multiple databases to identify systematic reviews and meta-analyses published between 1 January 1993 and 30 May 2016 presenting evidence on diagnostic and treatment efficacy and cost-effectiveness. We conducted additional systematic search for individual studies published between 2010 and 2017. We assessed the methodological quality of reviews and studies using the AMSTAR, Newcastle–Ottawa Scale and QUADAS-II tools. Study synthesis and assessment of the certainty of the evidence was performed using GRADE (Grading of Recommendations Assessment, Development and Evaluation) approach. We included 28 systematic reviews and individual studies in this review. The GRADE certainty of evidence was low for the effectiveness of screening techniques and moderate to high for treatment efficacy. Antibody-detecting serological tests are the most effective screening tests for detection of both schistosomiasis and strongyloidiasis in low-endemicity settings, because they have higher sensitivity than conventional parasitological methods. Short courses of praziquantel and ivermectin were safe and highly effective and cost-effective in treating schistosomiasis and strongyloidiasis, respectively. Economic modelling suggests presumptive single-dose treatment of strongyloidiasis with ivermectin for all migrants is likely cost-effective, but feasibility of this strategy has yet to be demonstrated in clinical studies. The evidence supports screening and treatment for schistosomiasis and strongyloidiasis in migrants from endemic countries, to reduce morbidity and mortality. |
format | Online Article Text |
id | pubmed-6339107 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-63391072019-01-23 Effectiveness of Screening and Treatment Approaches for Schistosomiasis and Strongyloidiasis in Newly-Arrived Migrants from Endemic Countries in the EU/EEA: A Systematic Review Agbata, Eric N. Morton, Rachael L. Bisoffi, Zeno Bottieau, Emmanuel Greenaway, Christina Biggs, Beverley-A. Montero, Nadia Tran, Anh Rowbotham, Nick Arevalo-Rodriguez, Ingrid Myran, Daniel T. Noori, Teymur Alonso-Coello, Pablo Pottie, Kevin Requena-Méndez, Ana Int J Environ Res Public Health Review We aimed to evaluate the evidence on screening and treatment for two parasitic infections—schistosomiasis and strongyloidiasis—among migrants from endemic countries arriving in the European Union and European Economic Area (EU/EEA). We conducted a systematic search of multiple databases to identify systematic reviews and meta-analyses published between 1 January 1993 and 30 May 2016 presenting evidence on diagnostic and treatment efficacy and cost-effectiveness. We conducted additional systematic search for individual studies published between 2010 and 2017. We assessed the methodological quality of reviews and studies using the AMSTAR, Newcastle–Ottawa Scale and QUADAS-II tools. Study synthesis and assessment of the certainty of the evidence was performed using GRADE (Grading of Recommendations Assessment, Development and Evaluation) approach. We included 28 systematic reviews and individual studies in this review. The GRADE certainty of evidence was low for the effectiveness of screening techniques and moderate to high for treatment efficacy. Antibody-detecting serological tests are the most effective screening tests for detection of both schistosomiasis and strongyloidiasis in low-endemicity settings, because they have higher sensitivity than conventional parasitological methods. Short courses of praziquantel and ivermectin were safe and highly effective and cost-effective in treating schistosomiasis and strongyloidiasis, respectively. Economic modelling suggests presumptive single-dose treatment of strongyloidiasis with ivermectin for all migrants is likely cost-effective, but feasibility of this strategy has yet to be demonstrated in clinical studies. The evidence supports screening and treatment for schistosomiasis and strongyloidiasis in migrants from endemic countries, to reduce morbidity and mortality. MDPI 2018-12-20 2019-01 /pmc/articles/PMC6339107/ /pubmed/30577567 http://dx.doi.org/10.3390/ijerph16010011 Text en © 2018 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/). |
spellingShingle | Review Agbata, Eric N. Morton, Rachael L. Bisoffi, Zeno Bottieau, Emmanuel Greenaway, Christina Biggs, Beverley-A. Montero, Nadia Tran, Anh Rowbotham, Nick Arevalo-Rodriguez, Ingrid Myran, Daniel T. Noori, Teymur Alonso-Coello, Pablo Pottie, Kevin Requena-Méndez, Ana Effectiveness of Screening and Treatment Approaches for Schistosomiasis and Strongyloidiasis in Newly-Arrived Migrants from Endemic Countries in the EU/EEA: A Systematic Review |
title | Effectiveness of Screening and Treatment Approaches for Schistosomiasis and Strongyloidiasis in Newly-Arrived Migrants from Endemic Countries in the EU/EEA: A Systematic Review |
title_full | Effectiveness of Screening and Treatment Approaches for Schistosomiasis and Strongyloidiasis in Newly-Arrived Migrants from Endemic Countries in the EU/EEA: A Systematic Review |
title_fullStr | Effectiveness of Screening and Treatment Approaches for Schistosomiasis and Strongyloidiasis in Newly-Arrived Migrants from Endemic Countries in the EU/EEA: A Systematic Review |
title_full_unstemmed | Effectiveness of Screening and Treatment Approaches for Schistosomiasis and Strongyloidiasis in Newly-Arrived Migrants from Endemic Countries in the EU/EEA: A Systematic Review |
title_short | Effectiveness of Screening and Treatment Approaches for Schistosomiasis and Strongyloidiasis in Newly-Arrived Migrants from Endemic Countries in the EU/EEA: A Systematic Review |
title_sort | effectiveness of screening and treatment approaches for schistosomiasis and strongyloidiasis in newly-arrived migrants from endemic countries in the eu/eea: a systematic review |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6339107/ https://www.ncbi.nlm.nih.gov/pubmed/30577567 http://dx.doi.org/10.3390/ijerph16010011 |
work_keys_str_mv | AT agbataericn effectivenessofscreeningandtreatmentapproachesforschistosomiasisandstrongyloidiasisinnewlyarrivedmigrantsfromendemiccountriesintheeueeaasystematicreview AT mortonrachaell effectivenessofscreeningandtreatmentapproachesforschistosomiasisandstrongyloidiasisinnewlyarrivedmigrantsfromendemiccountriesintheeueeaasystematicreview AT bisoffizeno effectivenessofscreeningandtreatmentapproachesforschistosomiasisandstrongyloidiasisinnewlyarrivedmigrantsfromendemiccountriesintheeueeaasystematicreview AT bottieauemmanuel effectivenessofscreeningandtreatmentapproachesforschistosomiasisandstrongyloidiasisinnewlyarrivedmigrantsfromendemiccountriesintheeueeaasystematicreview AT greenawaychristina effectivenessofscreeningandtreatmentapproachesforschistosomiasisandstrongyloidiasisinnewlyarrivedmigrantsfromendemiccountriesintheeueeaasystematicreview AT biggsbeverleya effectivenessofscreeningandtreatmentapproachesforschistosomiasisandstrongyloidiasisinnewlyarrivedmigrantsfromendemiccountriesintheeueeaasystematicreview AT monteronadia effectivenessofscreeningandtreatmentapproachesforschistosomiasisandstrongyloidiasisinnewlyarrivedmigrantsfromendemiccountriesintheeueeaasystematicreview AT trananh effectivenessofscreeningandtreatmentapproachesforschistosomiasisandstrongyloidiasisinnewlyarrivedmigrantsfromendemiccountriesintheeueeaasystematicreview AT rowbothamnick effectivenessofscreeningandtreatmentapproachesforschistosomiasisandstrongyloidiasisinnewlyarrivedmigrantsfromendemiccountriesintheeueeaasystematicreview AT arevalorodriguezingrid effectivenessofscreeningandtreatmentapproachesforschistosomiasisandstrongyloidiasisinnewlyarrivedmigrantsfromendemiccountriesintheeueeaasystematicreview AT myrandanielt effectivenessofscreeningandtreatmentapproachesforschistosomiasisandstrongyloidiasisinnewlyarrivedmigrantsfromendemiccountriesintheeueeaasystematicreview AT nooriteymur effectivenessofscreeningandtreatmentapproachesforschistosomiasisandstrongyloidiasisinnewlyarrivedmigrantsfromendemiccountriesintheeueeaasystematicreview AT alonsocoellopablo effectivenessofscreeningandtreatmentapproachesforschistosomiasisandstrongyloidiasisinnewlyarrivedmigrantsfromendemiccountriesintheeueeaasystematicreview AT pottiekevin effectivenessofscreeningandtreatmentapproachesforschistosomiasisandstrongyloidiasisinnewlyarrivedmigrantsfromendemiccountriesintheeueeaasystematicreview AT requenamendezana effectivenessofscreeningandtreatmentapproachesforschistosomiasisandstrongyloidiasisinnewlyarrivedmigrantsfromendemiccountriesintheeueeaasystematicreview |