Cargando…
Spatial patterns of white matter hyperintensities associated with Alzheimer’s disease risk factors in a cognitively healthy middle-aged cohort
BACKGROUND: White matter hyperintensities (WMH) of presumed vascular origin have been associated with an increased risk of Alzheimer’s disease (AD). This study aims to describe the patterns of WMH associated with dementia risk estimates and individual risk factors in a cohort of middle-aged/late mid...
Autores principales: | , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6346579/ https://www.ncbi.nlm.nih.gov/pubmed/30678723 http://dx.doi.org/10.1186/s13195-018-0460-1 |
_version_ | 1783389782520365056 |
---|---|
author | Salvadó, Gemma Brugulat-Serrat, Anna Sudre, Carole H. Grau-Rivera, Oriol Suárez-Calvet, Marc Falcon, Carles Fauria, Karine Cardoso, M. Jorge Barkhof, Frederik Molinuevo, José Luis Gispert, Juan Domingo |
author_facet | Salvadó, Gemma Brugulat-Serrat, Anna Sudre, Carole H. Grau-Rivera, Oriol Suárez-Calvet, Marc Falcon, Carles Fauria, Karine Cardoso, M. Jorge Barkhof, Frederik Molinuevo, José Luis Gispert, Juan Domingo |
author_sort | Salvadó, Gemma |
collection | PubMed |
description | BACKGROUND: White matter hyperintensities (WMH) of presumed vascular origin have been associated with an increased risk of Alzheimer’s disease (AD). This study aims to describe the patterns of WMH associated with dementia risk estimates and individual risk factors in a cohort of middle-aged/late middle-aged individuals (mean 58 (interquartile range 51–64) years old). METHODS: Magnetic resonance imaging and AD risk factors were collected from 575 cognitively unimpaired participants. WMH load was automatically calculated in each brain lobe and in four equidistant layers from the ventricular surface to the cortical interface. Global volumes and regional patterns of WMH load were analyzed as a function of the Cardiovascular Risk Factors, Aging and Incidence of Dementia (CAIDE) dementia risk score, as well as family history of AD and Apolipoprotein E (APOE) genotype. Additional analyses were performed after correcting for the effect of age and hypertension. RESULTS: The studied cohort showed very low WMH burden (median 1.94 cm(3)) and 20-year dementia risk estimates (median 1.47 %). Even so, higher CAIDE scores were significantly associated with increased global WMH load. The main drivers of this association were age and hypertension, with hypercholesterolemia and body mass index also displaying a minor, albeit significant, influence. Regionally, CAIDE scores were positively associated with WMH in anterior areas, mostly in the frontal lobe. Age and hypertension showed significant association with WMH in almost all regions analyzed. The APOE-ε2 allele showed a protective effect over global WMH with a pattern that comprised juxtacortical temporo-occipital and fronto-parietal deep white matter regions. Participants with maternal family history of AD had higher WMH load than those without, especially in temporal and occipital lobes. CONCLUSIONS: WMH load is associated with AD risk factors even in cognitively unimpaired subjects with very low WMH burden and dementia risk estimates. Our results suggest that tight control of modifiable risk factors in middle-age/late middle-age could have a significant impact on late-life dementia. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13195-018-0460-1) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-6346579 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-63465792019-01-29 Spatial patterns of white matter hyperintensities associated with Alzheimer’s disease risk factors in a cognitively healthy middle-aged cohort Salvadó, Gemma Brugulat-Serrat, Anna Sudre, Carole H. Grau-Rivera, Oriol Suárez-Calvet, Marc Falcon, Carles Fauria, Karine Cardoso, M. Jorge Barkhof, Frederik Molinuevo, José Luis Gispert, Juan Domingo Alzheimers Res Ther Research BACKGROUND: White matter hyperintensities (WMH) of presumed vascular origin have been associated with an increased risk of Alzheimer’s disease (AD). This study aims to describe the patterns of WMH associated with dementia risk estimates and individual risk factors in a cohort of middle-aged/late middle-aged individuals (mean 58 (interquartile range 51–64) years old). METHODS: Magnetic resonance imaging and AD risk factors were collected from 575 cognitively unimpaired participants. WMH load was automatically calculated in each brain lobe and in four equidistant layers from the ventricular surface to the cortical interface. Global volumes and regional patterns of WMH load were analyzed as a function of the Cardiovascular Risk Factors, Aging and Incidence of Dementia (CAIDE) dementia risk score, as well as family history of AD and Apolipoprotein E (APOE) genotype. Additional analyses were performed after correcting for the effect of age and hypertension. RESULTS: The studied cohort showed very low WMH burden (median 1.94 cm(3)) and 20-year dementia risk estimates (median 1.47 %). Even so, higher CAIDE scores were significantly associated with increased global WMH load. The main drivers of this association were age and hypertension, with hypercholesterolemia and body mass index also displaying a minor, albeit significant, influence. Regionally, CAIDE scores were positively associated with WMH in anterior areas, mostly in the frontal lobe. Age and hypertension showed significant association with WMH in almost all regions analyzed. The APOE-ε2 allele showed a protective effect over global WMH with a pattern that comprised juxtacortical temporo-occipital and fronto-parietal deep white matter regions. Participants with maternal family history of AD had higher WMH load than those without, especially in temporal and occipital lobes. CONCLUSIONS: WMH load is associated with AD risk factors even in cognitively unimpaired subjects with very low WMH burden and dementia risk estimates. Our results suggest that tight control of modifiable risk factors in middle-age/late middle-age could have a significant impact on late-life dementia. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13195-018-0460-1) contains supplementary material, which is available to authorized users. BioMed Central 2019-01-24 /pmc/articles/PMC6346579/ /pubmed/30678723 http://dx.doi.org/10.1186/s13195-018-0460-1 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Salvadó, Gemma Brugulat-Serrat, Anna Sudre, Carole H. Grau-Rivera, Oriol Suárez-Calvet, Marc Falcon, Carles Fauria, Karine Cardoso, M. Jorge Barkhof, Frederik Molinuevo, José Luis Gispert, Juan Domingo Spatial patterns of white matter hyperintensities associated with Alzheimer’s disease risk factors in a cognitively healthy middle-aged cohort |
title | Spatial patterns of white matter hyperintensities associated with Alzheimer’s disease risk factors in a cognitively healthy middle-aged cohort |
title_full | Spatial patterns of white matter hyperintensities associated with Alzheimer’s disease risk factors in a cognitively healthy middle-aged cohort |
title_fullStr | Spatial patterns of white matter hyperintensities associated with Alzheimer’s disease risk factors in a cognitively healthy middle-aged cohort |
title_full_unstemmed | Spatial patterns of white matter hyperintensities associated with Alzheimer’s disease risk factors in a cognitively healthy middle-aged cohort |
title_short | Spatial patterns of white matter hyperintensities associated with Alzheimer’s disease risk factors in a cognitively healthy middle-aged cohort |
title_sort | spatial patterns of white matter hyperintensities associated with alzheimer’s disease risk factors in a cognitively healthy middle-aged cohort |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6346579/ https://www.ncbi.nlm.nih.gov/pubmed/30678723 http://dx.doi.org/10.1186/s13195-018-0460-1 |
work_keys_str_mv | AT salvadogemma spatialpatternsofwhitematterhyperintensitiesassociatedwithalzheimersdiseaseriskfactorsinacognitivelyhealthymiddleagedcohort AT brugulatserratanna spatialpatternsofwhitematterhyperintensitiesassociatedwithalzheimersdiseaseriskfactorsinacognitivelyhealthymiddleagedcohort AT sudrecaroleh spatialpatternsofwhitematterhyperintensitiesassociatedwithalzheimersdiseaseriskfactorsinacognitivelyhealthymiddleagedcohort AT grauriveraoriol spatialpatternsofwhitematterhyperintensitiesassociatedwithalzheimersdiseaseriskfactorsinacognitivelyhealthymiddleagedcohort AT suarezcalvetmarc spatialpatternsofwhitematterhyperintensitiesassociatedwithalzheimersdiseaseriskfactorsinacognitivelyhealthymiddleagedcohort AT falconcarles spatialpatternsofwhitematterhyperintensitiesassociatedwithalzheimersdiseaseriskfactorsinacognitivelyhealthymiddleagedcohort AT fauriakarine spatialpatternsofwhitematterhyperintensitiesassociatedwithalzheimersdiseaseriskfactorsinacognitivelyhealthymiddleagedcohort AT cardosomjorge spatialpatternsofwhitematterhyperintensitiesassociatedwithalzheimersdiseaseriskfactorsinacognitivelyhealthymiddleagedcohort AT barkhoffrederik spatialpatternsofwhitematterhyperintensitiesassociatedwithalzheimersdiseaseriskfactorsinacognitivelyhealthymiddleagedcohort AT molinuevojoseluis spatialpatternsofwhitematterhyperintensitiesassociatedwithalzheimersdiseaseriskfactorsinacognitivelyhealthymiddleagedcohort AT gispertjuandomingo spatialpatternsofwhitematterhyperintensitiesassociatedwithalzheimersdiseaseriskfactorsinacognitivelyhealthymiddleagedcohort AT spatialpatternsofwhitematterhyperintensitiesassociatedwithalzheimersdiseaseriskfactorsinacognitivelyhealthymiddleagedcohort |