Cargando…
IgG4:IgG RNA ratio differentiates active disease from remission in granulomatosis with polyangiitis: a new disease activity marker? A cross-sectional and longitudinal study
OBJECTIVES: An important limitation in granulomatosis with polyangiitis (GPA) is the lack of disease activity markers. Immunoglobulin G4-positive (IgG4(+)) B cells and plasma cells are implicated in the pathogenesis of GPA. We hypothesized that the presence of these cells in peripheral blood could s...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6357433/ https://www.ncbi.nlm.nih.gov/pubmed/30704507 http://dx.doi.org/10.1186/s13075-018-1806-6 |
_version_ | 1783391791054061568 |
---|---|
author | Al-Soudi, A. Doorenspleet, M. E. Esveldt, R. E. Burgemeister, L. T. Hak, A. E. van den Born, B. J. H. Tas, S. W. van Vollenhoven, R. F. Klarenbeek, P. L. de Vries, N. |
author_facet | Al-Soudi, A. Doorenspleet, M. E. Esveldt, R. E. Burgemeister, L. T. Hak, A. E. van den Born, B. J. H. Tas, S. W. van Vollenhoven, R. F. Klarenbeek, P. L. de Vries, N. |
author_sort | Al-Soudi, A. |
collection | PubMed |
description | OBJECTIVES: An important limitation in granulomatosis with polyangiitis (GPA) is the lack of disease activity markers. Immunoglobulin G4-positive (IgG4(+)) B cells and plasma cells are implicated in the pathogenesis of GPA. We hypothesized that the presence of these cells in peripheral blood could serve as disease activity parameter in GPA. METHODS: We included 35 proteinase 3-antineutrophil cytoplasmic antibodies-positive patients with GPA in a cross-sectional study. Active disease was defined as Birmingham Vasculitis Activity Score (BVAS) ≥ 3 (n = 15), remission as BVAS of 0 (n = 17), and low disease activity (LDA) as BVAS of 1–2 and clinical remission (n = 3). Healthy subjects (n = 10), patients with systemic lupus erythematosus (n = 24), and patients with rheumatoid arthritis (n = 19) functioned as control subjects. An additional longitudinal study was performed in ten patients with GPA. Using a validated qPCR test, we measured the IgG4:IgG RNA ratio in all groups and compared the results with known biomarkers. RESULTS: The median qPCR score was higher in active GPA (21.4; IQR 12.1–29.6) than in remission/LDA (3.3; IQR 1.6–5.6) (Mann-Whitney U test, p < 0.0001) and outperformed other known disease activity parameters in detecting activity. A cutoff qPCR score of 11.2% differentiated active disease from remission/LDA accurately (AUC 0.993). The qPCR test correlated well with the BVAS (Spearman r = 0.77, p < 0.0001). In the longitudinal study, a decrease in BVAS correlated with qPCR score reduction (paired t test, p < 0.05). CONCLUSIONS: The IgG4:IgG RNA ratio in GPA accurately distinguishes active disease from remission and correlates well with disease activity in these single-center studies. If these results are confirmed in larger longitudinal studies, this test might help to steer treatment decisions in patients with GPA. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13075-018-1806-6) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-6357433 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-63574332019-02-07 IgG4:IgG RNA ratio differentiates active disease from remission in granulomatosis with polyangiitis: a new disease activity marker? A cross-sectional and longitudinal study Al-Soudi, A. Doorenspleet, M. E. Esveldt, R. E. Burgemeister, L. T. Hak, A. E. van den Born, B. J. H. Tas, S. W. van Vollenhoven, R. F. Klarenbeek, P. L. de Vries, N. Arthritis Res Ther Research Article OBJECTIVES: An important limitation in granulomatosis with polyangiitis (GPA) is the lack of disease activity markers. Immunoglobulin G4-positive (IgG4(+)) B cells and plasma cells are implicated in the pathogenesis of GPA. We hypothesized that the presence of these cells in peripheral blood could serve as disease activity parameter in GPA. METHODS: We included 35 proteinase 3-antineutrophil cytoplasmic antibodies-positive patients with GPA in a cross-sectional study. Active disease was defined as Birmingham Vasculitis Activity Score (BVAS) ≥ 3 (n = 15), remission as BVAS of 0 (n = 17), and low disease activity (LDA) as BVAS of 1–2 and clinical remission (n = 3). Healthy subjects (n = 10), patients with systemic lupus erythematosus (n = 24), and patients with rheumatoid arthritis (n = 19) functioned as control subjects. An additional longitudinal study was performed in ten patients with GPA. Using a validated qPCR test, we measured the IgG4:IgG RNA ratio in all groups and compared the results with known biomarkers. RESULTS: The median qPCR score was higher in active GPA (21.4; IQR 12.1–29.6) than in remission/LDA (3.3; IQR 1.6–5.6) (Mann-Whitney U test, p < 0.0001) and outperformed other known disease activity parameters in detecting activity. A cutoff qPCR score of 11.2% differentiated active disease from remission/LDA accurately (AUC 0.993). The qPCR test correlated well with the BVAS (Spearman r = 0.77, p < 0.0001). In the longitudinal study, a decrease in BVAS correlated with qPCR score reduction (paired t test, p < 0.05). CONCLUSIONS: The IgG4:IgG RNA ratio in GPA accurately distinguishes active disease from remission and correlates well with disease activity in these single-center studies. If these results are confirmed in larger longitudinal studies, this test might help to steer treatment decisions in patients with GPA. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13075-018-1806-6) contains supplementary material, which is available to authorized users. BioMed Central 2019-01-31 2019 /pmc/articles/PMC6357433/ /pubmed/30704507 http://dx.doi.org/10.1186/s13075-018-1806-6 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Al-Soudi, A. Doorenspleet, M. E. Esveldt, R. E. Burgemeister, L. T. Hak, A. E. van den Born, B. J. H. Tas, S. W. van Vollenhoven, R. F. Klarenbeek, P. L. de Vries, N. IgG4:IgG RNA ratio differentiates active disease from remission in granulomatosis with polyangiitis: a new disease activity marker? A cross-sectional and longitudinal study |
title | IgG4:IgG RNA ratio differentiates active disease from remission in granulomatosis with polyangiitis: a new disease activity marker? A cross-sectional and longitudinal study |
title_full | IgG4:IgG RNA ratio differentiates active disease from remission in granulomatosis with polyangiitis: a new disease activity marker? A cross-sectional and longitudinal study |
title_fullStr | IgG4:IgG RNA ratio differentiates active disease from remission in granulomatosis with polyangiitis: a new disease activity marker? A cross-sectional and longitudinal study |
title_full_unstemmed | IgG4:IgG RNA ratio differentiates active disease from remission in granulomatosis with polyangiitis: a new disease activity marker? A cross-sectional and longitudinal study |
title_short | IgG4:IgG RNA ratio differentiates active disease from remission in granulomatosis with polyangiitis: a new disease activity marker? A cross-sectional and longitudinal study |
title_sort | igg4:igg rna ratio differentiates active disease from remission in granulomatosis with polyangiitis: a new disease activity marker? a cross-sectional and longitudinal study |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6357433/ https://www.ncbi.nlm.nih.gov/pubmed/30704507 http://dx.doi.org/10.1186/s13075-018-1806-6 |
work_keys_str_mv | AT alsoudia igg4iggrnaratiodifferentiatesactivediseasefromremissioningranulomatosiswithpolyangiitisanewdiseaseactivitymarkeracrosssectionalandlongitudinalstudy AT doorenspleetme igg4iggrnaratiodifferentiatesactivediseasefromremissioningranulomatosiswithpolyangiitisanewdiseaseactivitymarkeracrosssectionalandlongitudinalstudy AT esveldtre igg4iggrnaratiodifferentiatesactivediseasefromremissioningranulomatosiswithpolyangiitisanewdiseaseactivitymarkeracrosssectionalandlongitudinalstudy AT burgemeisterlt igg4iggrnaratiodifferentiatesactivediseasefromremissioningranulomatosiswithpolyangiitisanewdiseaseactivitymarkeracrosssectionalandlongitudinalstudy AT hakae igg4iggrnaratiodifferentiatesactivediseasefromremissioningranulomatosiswithpolyangiitisanewdiseaseactivitymarkeracrosssectionalandlongitudinalstudy AT vandenbornbjh igg4iggrnaratiodifferentiatesactivediseasefromremissioningranulomatosiswithpolyangiitisanewdiseaseactivitymarkeracrosssectionalandlongitudinalstudy AT tassw igg4iggrnaratiodifferentiatesactivediseasefromremissioningranulomatosiswithpolyangiitisanewdiseaseactivitymarkeracrosssectionalandlongitudinalstudy AT vanvollenhovenrf igg4iggrnaratiodifferentiatesactivediseasefromremissioningranulomatosiswithpolyangiitisanewdiseaseactivitymarkeracrosssectionalandlongitudinalstudy AT klarenbeekpl igg4iggrnaratiodifferentiatesactivediseasefromremissioningranulomatosiswithpolyangiitisanewdiseaseactivitymarkeracrosssectionalandlongitudinalstudy AT devriesn igg4iggrnaratiodifferentiatesactivediseasefromremissioningranulomatosiswithpolyangiitisanewdiseaseactivitymarkeracrosssectionalandlongitudinalstudy |