Cargando…
Cordycepin promotes browning of white adipose tissue through an AMP-activated protein kinase (AMPK)-dependent pathway
Obesity is a worldwide epidemic. Promoting browning of white adipose tissue (WAT) contributes to increased energy expenditure and hence counteracts obesity. Here we show that cordycepin (Cpn), a natural derivative of adenosine, increases energy expenditure, inhibits weight gain, improves metabolic p...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Elsevier
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6361849/ https://www.ncbi.nlm.nih.gov/pubmed/30766785 http://dx.doi.org/10.1016/j.apsb.2018.10.004 |
_version_ | 1783392755167264768 |
---|---|
author | Qi, Guihong Zhou, Yue Zhang, Xiaopo Yu, Jiaqi Li, Xin Cao, Xiaoxue Wu, Chongming Guo, Peng |
author_facet | Qi, Guihong Zhou, Yue Zhang, Xiaopo Yu, Jiaqi Li, Xin Cao, Xiaoxue Wu, Chongming Guo, Peng |
author_sort | Qi, Guihong |
collection | PubMed |
description | Obesity is a worldwide epidemic. Promoting browning of white adipose tissue (WAT) contributes to increased energy expenditure and hence counteracts obesity. Here we show that cordycepin (Cpn), a natural derivative of adenosine, increases energy expenditure, inhibits weight gain, improves metabolic profile and glucose tolerance, decreases WAT mass and adipocyte size, and enhances cold tolerance in normal and high-fat diet-fed mice. Cpn markedly increases the surface temperature around the inguinal WAT and turns the inguinal fat browner. Further investigations show that Cpn induces the development of brown-like adipocytes in inguinal and, to a less degree, epididymal WAT depots. Cpn also increases the expression of uncoupling protein 1 (UCP1) and other thermogenic genes in WAT and 3T3-L1 differentiated adipocytes, in which AMP-activated protein kinase (AMPK) plays an important role. Our results provide novel insights into the function of Cpn in regulating energy balance, and suggest a potential utility of Cpn in the treatment of obesity. |
format | Online Article Text |
id | pubmed-6361849 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | Elsevier |
record_format | MEDLINE/PubMed |
spelling | pubmed-63618492019-02-14 Cordycepin promotes browning of white adipose tissue through an AMP-activated protein kinase (AMPK)-dependent pathway Qi, Guihong Zhou, Yue Zhang, Xiaopo Yu, Jiaqi Li, Xin Cao, Xiaoxue Wu, Chongming Guo, Peng Acta Pharm Sin B Original article Obesity is a worldwide epidemic. Promoting browning of white adipose tissue (WAT) contributes to increased energy expenditure and hence counteracts obesity. Here we show that cordycepin (Cpn), a natural derivative of adenosine, increases energy expenditure, inhibits weight gain, improves metabolic profile and glucose tolerance, decreases WAT mass and adipocyte size, and enhances cold tolerance in normal and high-fat diet-fed mice. Cpn markedly increases the surface temperature around the inguinal WAT and turns the inguinal fat browner. Further investigations show that Cpn induces the development of brown-like adipocytes in inguinal and, to a less degree, epididymal WAT depots. Cpn also increases the expression of uncoupling protein 1 (UCP1) and other thermogenic genes in WAT and 3T3-L1 differentiated adipocytes, in which AMP-activated protein kinase (AMPK) plays an important role. Our results provide novel insights into the function of Cpn in regulating energy balance, and suggest a potential utility of Cpn in the treatment of obesity. Elsevier 2019-01 2018-10-17 /pmc/articles/PMC6361849/ /pubmed/30766785 http://dx.doi.org/10.1016/j.apsb.2018.10.004 Text en © 2018 Chinese Pharmaceutical Association and Institute of Materia Medica, Chinese Academy of Medical Sciences. Production and hosting by Elsevier B.V. http://creativecommons.org/licenses/by-nc-nd/4.0/ This is an open access article under the CC BY-NC-ND license (http://creativecommons.org/licenses/by-nc-nd/4.0/). |
spellingShingle | Original article Qi, Guihong Zhou, Yue Zhang, Xiaopo Yu, Jiaqi Li, Xin Cao, Xiaoxue Wu, Chongming Guo, Peng Cordycepin promotes browning of white adipose tissue through an AMP-activated protein kinase (AMPK)-dependent pathway |
title | Cordycepin promotes browning of white adipose tissue through an AMP-activated protein kinase (AMPK)-dependent pathway |
title_full | Cordycepin promotes browning of white adipose tissue through an AMP-activated protein kinase (AMPK)-dependent pathway |
title_fullStr | Cordycepin promotes browning of white adipose tissue through an AMP-activated protein kinase (AMPK)-dependent pathway |
title_full_unstemmed | Cordycepin promotes browning of white adipose tissue through an AMP-activated protein kinase (AMPK)-dependent pathway |
title_short | Cordycepin promotes browning of white adipose tissue through an AMP-activated protein kinase (AMPK)-dependent pathway |
title_sort | cordycepin promotes browning of white adipose tissue through an amp-activated protein kinase (ampk)-dependent pathway |
topic | Original article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6361849/ https://www.ncbi.nlm.nih.gov/pubmed/30766785 http://dx.doi.org/10.1016/j.apsb.2018.10.004 |
work_keys_str_mv | AT qiguihong cordycepinpromotesbrowningofwhiteadiposetissuethroughanampactivatedproteinkinaseampkdependentpathway AT zhouyue cordycepinpromotesbrowningofwhiteadiposetissuethroughanampactivatedproteinkinaseampkdependentpathway AT zhangxiaopo cordycepinpromotesbrowningofwhiteadiposetissuethroughanampactivatedproteinkinaseampkdependentpathway AT yujiaqi cordycepinpromotesbrowningofwhiteadiposetissuethroughanampactivatedproteinkinaseampkdependentpathway AT lixin cordycepinpromotesbrowningofwhiteadiposetissuethroughanampactivatedproteinkinaseampkdependentpathway AT caoxiaoxue cordycepinpromotesbrowningofwhiteadiposetissuethroughanampactivatedproteinkinaseampkdependentpathway AT wuchongming cordycepinpromotesbrowningofwhiteadiposetissuethroughanampactivatedproteinkinaseampkdependentpathway AT guopeng cordycepinpromotesbrowningofwhiteadiposetissuethroughanampactivatedproteinkinaseampkdependentpathway |