Cargando…

Cordycepin promotes browning of white adipose tissue through an AMP-activated protein kinase (AMPK)-dependent pathway

Obesity is a worldwide epidemic. Promoting browning of white adipose tissue (WAT) contributes to increased energy expenditure and hence counteracts obesity. Here we show that cordycepin (Cpn), a natural derivative of adenosine, increases energy expenditure, inhibits weight gain, improves metabolic p...

Descripción completa

Detalles Bibliográficos
Autores principales: Qi, Guihong, Zhou, Yue, Zhang, Xiaopo, Yu, Jiaqi, Li, Xin, Cao, Xiaoxue, Wu, Chongming, Guo, Peng
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Elsevier 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6361849/
https://www.ncbi.nlm.nih.gov/pubmed/30766785
http://dx.doi.org/10.1016/j.apsb.2018.10.004
_version_ 1783392755167264768
author Qi, Guihong
Zhou, Yue
Zhang, Xiaopo
Yu, Jiaqi
Li, Xin
Cao, Xiaoxue
Wu, Chongming
Guo, Peng
author_facet Qi, Guihong
Zhou, Yue
Zhang, Xiaopo
Yu, Jiaqi
Li, Xin
Cao, Xiaoxue
Wu, Chongming
Guo, Peng
author_sort Qi, Guihong
collection PubMed
description Obesity is a worldwide epidemic. Promoting browning of white adipose tissue (WAT) contributes to increased energy expenditure and hence counteracts obesity. Here we show that cordycepin (Cpn), a natural derivative of adenosine, increases energy expenditure, inhibits weight gain, improves metabolic profile and glucose tolerance, decreases WAT mass and adipocyte size, and enhances cold tolerance in normal and high-fat diet-fed mice. Cpn markedly increases the surface temperature around the inguinal WAT and turns the inguinal fat browner. Further investigations show that Cpn induces the development of brown-like adipocytes in inguinal and, to a less degree, epididymal WAT depots. Cpn also increases the expression of uncoupling protein 1 (UCP1) and other thermogenic genes in WAT and 3T3-L1 differentiated adipocytes, in which AMP-activated protein kinase (AMPK) plays an important role. Our results provide novel insights into the function of Cpn in regulating energy balance, and suggest a potential utility of Cpn in the treatment of obesity.
format Online
Article
Text
id pubmed-6361849
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher Elsevier
record_format MEDLINE/PubMed
spelling pubmed-63618492019-02-14 Cordycepin promotes browning of white adipose tissue through an AMP-activated protein kinase (AMPK)-dependent pathway Qi, Guihong Zhou, Yue Zhang, Xiaopo Yu, Jiaqi Li, Xin Cao, Xiaoxue Wu, Chongming Guo, Peng Acta Pharm Sin B Original article Obesity is a worldwide epidemic. Promoting browning of white adipose tissue (WAT) contributes to increased energy expenditure and hence counteracts obesity. Here we show that cordycepin (Cpn), a natural derivative of adenosine, increases energy expenditure, inhibits weight gain, improves metabolic profile and glucose tolerance, decreases WAT mass and adipocyte size, and enhances cold tolerance in normal and high-fat diet-fed mice. Cpn markedly increases the surface temperature around the inguinal WAT and turns the inguinal fat browner. Further investigations show that Cpn induces the development of brown-like adipocytes in inguinal and, to a less degree, epididymal WAT depots. Cpn also increases the expression of uncoupling protein 1 (UCP1) and other thermogenic genes in WAT and 3T3-L1 differentiated adipocytes, in which AMP-activated protein kinase (AMPK) plays an important role. Our results provide novel insights into the function of Cpn in regulating energy balance, and suggest a potential utility of Cpn in the treatment of obesity. Elsevier 2019-01 2018-10-17 /pmc/articles/PMC6361849/ /pubmed/30766785 http://dx.doi.org/10.1016/j.apsb.2018.10.004 Text en © 2018 Chinese Pharmaceutical Association and Institute of Materia Medica, Chinese Academy of Medical Sciences. Production and hosting by Elsevier B.V. http://creativecommons.org/licenses/by-nc-nd/4.0/ This is an open access article under the CC BY-NC-ND license (http://creativecommons.org/licenses/by-nc-nd/4.0/).
spellingShingle Original article
Qi, Guihong
Zhou, Yue
Zhang, Xiaopo
Yu, Jiaqi
Li, Xin
Cao, Xiaoxue
Wu, Chongming
Guo, Peng
Cordycepin promotes browning of white adipose tissue through an AMP-activated protein kinase (AMPK)-dependent pathway
title Cordycepin promotes browning of white adipose tissue through an AMP-activated protein kinase (AMPK)-dependent pathway
title_full Cordycepin promotes browning of white adipose tissue through an AMP-activated protein kinase (AMPK)-dependent pathway
title_fullStr Cordycepin promotes browning of white adipose tissue through an AMP-activated protein kinase (AMPK)-dependent pathway
title_full_unstemmed Cordycepin promotes browning of white adipose tissue through an AMP-activated protein kinase (AMPK)-dependent pathway
title_short Cordycepin promotes browning of white adipose tissue through an AMP-activated protein kinase (AMPK)-dependent pathway
title_sort cordycepin promotes browning of white adipose tissue through an amp-activated protein kinase (ampk)-dependent pathway
topic Original article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6361849/
https://www.ncbi.nlm.nih.gov/pubmed/30766785
http://dx.doi.org/10.1016/j.apsb.2018.10.004
work_keys_str_mv AT qiguihong cordycepinpromotesbrowningofwhiteadiposetissuethroughanampactivatedproteinkinaseampkdependentpathway
AT zhouyue cordycepinpromotesbrowningofwhiteadiposetissuethroughanampactivatedproteinkinaseampkdependentpathway
AT zhangxiaopo cordycepinpromotesbrowningofwhiteadiposetissuethroughanampactivatedproteinkinaseampkdependentpathway
AT yujiaqi cordycepinpromotesbrowningofwhiteadiposetissuethroughanampactivatedproteinkinaseampkdependentpathway
AT lixin cordycepinpromotesbrowningofwhiteadiposetissuethroughanampactivatedproteinkinaseampkdependentpathway
AT caoxiaoxue cordycepinpromotesbrowningofwhiteadiposetissuethroughanampactivatedproteinkinaseampkdependentpathway
AT wuchongming cordycepinpromotesbrowningofwhiteadiposetissuethroughanampactivatedproteinkinaseampkdependentpathway
AT guopeng cordycepinpromotesbrowningofwhiteadiposetissuethroughanampactivatedproteinkinaseampkdependentpathway