Cargando…

Estimating the burden of leptospirosis in Sri Lanka; a systematic review

BACKGROUND: Although the assessment of disease burden should be a priority for allocating resources, leptospirosis is grossly underestimated despite its true burden in Sri Lanka. This study aimed to assess the morbidity and mortality of leptospirosis based on routine surveillance data, hospital repo...

Descripción completa

Detalles Bibliográficos
Autores principales: Warnasekara, Janith, Koralegedara, Iresha, Agampodi, Suneth
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6364467/
https://www.ncbi.nlm.nih.gov/pubmed/30727968
http://dx.doi.org/10.1186/s12879-018-3655-y
_version_ 1783393284734844928
author Warnasekara, Janith
Koralegedara, Iresha
Agampodi, Suneth
author_facet Warnasekara, Janith
Koralegedara, Iresha
Agampodi, Suneth
author_sort Warnasekara, Janith
collection PubMed
description BACKGROUND: Although the assessment of disease burden should be a priority for allocating resources, leptospirosis is grossly underestimated despite its true burden in Sri Lanka. This study aimed to assess the morbidity and mortality of leptospirosis based on routine surveillance data, hospital reported data and scientific publications from Sri Lanka. METHOD: A systematic review was carried out, and Pub Med, MEDLINE®, BIOSIS Previews, Zoological Record, Web of Science Core Collection, Current Contents Connect, KCI-Korean Journal Database, BIOSIS Citation Index, Data Citation Index, SciELO Citation Index and Google Scholar databases were searched. Quarterly epidemiological bulletin (QEB), indoor morbidity & mortality returns (IMMR) and hand searches of local literature were performed in local libraries. Forty-two relevant full texts, 32 QEBs, and 8 IMMR were included in the full text review. Adjustments were made for under diagnosis, underreporting and chance variability. RESULTS: The estimated annual caseload of leptospirosis in Sri Lanka from 2008 to 2015, was 10,423, and the cumulative annual incidence of leptospirosis that required hospitalization was 52.1 (95% CI 51.7–52.6) per 100,000 people. The estimated number of annual deaths due to leptospirosis was approximately 730 (95% CI 542–980), with an estimated pooled case fatality ratio of 7.0% (95% CI 5.2–9.4). The most common organs involved were the kidney, liver and heart, with median rates of 48.7, 30, and 14.2%, respectively. CONCLUSION: Our systematic review shows gross underestimation of the true leptospirosis burden in the national statistics of Sri Lanka, and the hospitalization rates estimated in our study were compatible with the total burden estimate of 300·6 (95% CI 96·54–604·23) per 100,000 people published previously. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12879-018-3655-y) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-6364467
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-63644672019-02-15 Estimating the burden of leptospirosis in Sri Lanka; a systematic review Warnasekara, Janith Koralegedara, Iresha Agampodi, Suneth BMC Infect Dis Research Article BACKGROUND: Although the assessment of disease burden should be a priority for allocating resources, leptospirosis is grossly underestimated despite its true burden in Sri Lanka. This study aimed to assess the morbidity and mortality of leptospirosis based on routine surveillance data, hospital reported data and scientific publications from Sri Lanka. METHOD: A systematic review was carried out, and Pub Med, MEDLINE®, BIOSIS Previews, Zoological Record, Web of Science Core Collection, Current Contents Connect, KCI-Korean Journal Database, BIOSIS Citation Index, Data Citation Index, SciELO Citation Index and Google Scholar databases were searched. Quarterly epidemiological bulletin (QEB), indoor morbidity & mortality returns (IMMR) and hand searches of local literature were performed in local libraries. Forty-two relevant full texts, 32 QEBs, and 8 IMMR were included in the full text review. Adjustments were made for under diagnosis, underreporting and chance variability. RESULTS: The estimated annual caseload of leptospirosis in Sri Lanka from 2008 to 2015, was 10,423, and the cumulative annual incidence of leptospirosis that required hospitalization was 52.1 (95% CI 51.7–52.6) per 100,000 people. The estimated number of annual deaths due to leptospirosis was approximately 730 (95% CI 542–980), with an estimated pooled case fatality ratio of 7.0% (95% CI 5.2–9.4). The most common organs involved were the kidney, liver and heart, with median rates of 48.7, 30, and 14.2%, respectively. CONCLUSION: Our systematic review shows gross underestimation of the true leptospirosis burden in the national statistics of Sri Lanka, and the hospitalization rates estimated in our study were compatible with the total burden estimate of 300·6 (95% CI 96·54–604·23) per 100,000 people published previously. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12879-018-3655-y) contains supplementary material, which is available to authorized users. BioMed Central 2019-02-06 /pmc/articles/PMC6364467/ /pubmed/30727968 http://dx.doi.org/10.1186/s12879-018-3655-y Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Warnasekara, Janith
Koralegedara, Iresha
Agampodi, Suneth
Estimating the burden of leptospirosis in Sri Lanka; a systematic review
title Estimating the burden of leptospirosis in Sri Lanka; a systematic review
title_full Estimating the burden of leptospirosis in Sri Lanka; a systematic review
title_fullStr Estimating the burden of leptospirosis in Sri Lanka; a systematic review
title_full_unstemmed Estimating the burden of leptospirosis in Sri Lanka; a systematic review
title_short Estimating the burden of leptospirosis in Sri Lanka; a systematic review
title_sort estimating the burden of leptospirosis in sri lanka; a systematic review
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6364467/
https://www.ncbi.nlm.nih.gov/pubmed/30727968
http://dx.doi.org/10.1186/s12879-018-3655-y
work_keys_str_mv AT warnasekarajanith estimatingtheburdenofleptospirosisinsrilankaasystematicreview
AT koralegedarairesha estimatingtheburdenofleptospirosisinsrilankaasystematicreview
AT agampodisuneth estimatingtheburdenofleptospirosisinsrilankaasystematicreview