Cargando…

MicroRNA-98 suppresses cell growth and invasion of retinoblastoma via targeting the IGF1R/k-Ras/Raf/MEK/ERK signaling pathway

Accumulating evidence has indicated that the dysregulation of microRNAs (miRNAs) is involved in the pathogenesis o retinoblastoma (RB); however, the potential role of miR-98 in RB remains elusive. In the present study, it was demonstrated that miR-98 is downregulated in RB tissues and cell lines, an...

Descripción completa

Detalles Bibliográficos
Autores principales: Guo, Long, Bai, Yu, Ji, Shuzhe, Ma, Hong
Formato: Online Artículo Texto
Lenguaje:English
Publicado: D.A. Spandidos 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6365030/
https://www.ncbi.nlm.nih.gov/pubmed/30664191
http://dx.doi.org/10.3892/ijo.2019.4689
_version_ 1783393353702834176
author Guo, Long
Bai, Yu
Ji, Shuzhe
Ma, Hong
author_facet Guo, Long
Bai, Yu
Ji, Shuzhe
Ma, Hong
author_sort Guo, Long
collection PubMed
description Accumulating evidence has indicated that the dysregulation of microRNAs (miRNAs) is involved in the pathogenesis o retinoblastoma (RB); however, the potential role of miR-98 in RB remains elusive. In the present study, it was demonstrated that miR-98 is downregulated in RB tissues and cell lines, and its expression significantly associated with clinicopathological features, including differentiation, N classification and largest tumor base; patients with low miR-98 expression levels exhibited significantly poorer overall survival. Overexpression of miR-98 was suggested to suppress RB cell growth, migration and invasion. In addition, insulin-like growth factor-1 receptor (IGF1R), a well-reported oncogene, was identified as a potential target of miR-98 via a luciferase assay, reverse transcription-quantitative polymerase chain reaction and western blotting. Correlation analysis revealed a significantly negative correlation between miR-98 and IGF1R expression in tumor tissues (n=60). In addition, the results of the present study demonstrated that IGF1R function as an oncogene by promoting RB cell viability, migration and invasion. Furthermore, restoration of IGF1R was observed to reverse the anticancer effects of miR-98 on RB cell viability, migration and invasion. Importantly, the findings of the present study indicated that miR-98 suppressed RB cell growth and metastasis by inhibiting the IGF1R/k-Ras/Raf/mitogen activated protein kinase kinase/extracellular signal-regulated kinase signaling pathway. Collectively, the present study proposed that miR-98 may serve as a novel prognostic biomarker and therapeutic target in the treatment of RB.
format Online
Article
Text
id pubmed-6365030
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher D.A. Spandidos
record_format MEDLINE/PubMed
spelling pubmed-63650302019-02-19 MicroRNA-98 suppresses cell growth and invasion of retinoblastoma via targeting the IGF1R/k-Ras/Raf/MEK/ERK signaling pathway Guo, Long Bai, Yu Ji, Shuzhe Ma, Hong Int J Oncol Articles Accumulating evidence has indicated that the dysregulation of microRNAs (miRNAs) is involved in the pathogenesis o retinoblastoma (RB); however, the potential role of miR-98 in RB remains elusive. In the present study, it was demonstrated that miR-98 is downregulated in RB tissues and cell lines, and its expression significantly associated with clinicopathological features, including differentiation, N classification and largest tumor base; patients with low miR-98 expression levels exhibited significantly poorer overall survival. Overexpression of miR-98 was suggested to suppress RB cell growth, migration and invasion. In addition, insulin-like growth factor-1 receptor (IGF1R), a well-reported oncogene, was identified as a potential target of miR-98 via a luciferase assay, reverse transcription-quantitative polymerase chain reaction and western blotting. Correlation analysis revealed a significantly negative correlation between miR-98 and IGF1R expression in tumor tissues (n=60). In addition, the results of the present study demonstrated that IGF1R function as an oncogene by promoting RB cell viability, migration and invasion. Furthermore, restoration of IGF1R was observed to reverse the anticancer effects of miR-98 on RB cell viability, migration and invasion. Importantly, the findings of the present study indicated that miR-98 suppressed RB cell growth and metastasis by inhibiting the IGF1R/k-Ras/Raf/mitogen activated protein kinase kinase/extracellular signal-regulated kinase signaling pathway. Collectively, the present study proposed that miR-98 may serve as a novel prognostic biomarker and therapeutic target in the treatment of RB. D.A. Spandidos 2019-01-17 /pmc/articles/PMC6365030/ /pubmed/30664191 http://dx.doi.org/10.3892/ijo.2019.4689 Text en Copyright: © Guo et al. This is an open access article distributed under the terms of the Creative Commons Attribution-NonCommercial-NoDerivs License (https://creativecommons.org/licenses/by-nc-nd/4.0/) , which permits use and distribution in any medium, provided the original work is properly cited, the use is non-commercial and no modifications or adaptations are made.
spellingShingle Articles
Guo, Long
Bai, Yu
Ji, Shuzhe
Ma, Hong
MicroRNA-98 suppresses cell growth and invasion of retinoblastoma via targeting the IGF1R/k-Ras/Raf/MEK/ERK signaling pathway
title MicroRNA-98 suppresses cell growth and invasion of retinoblastoma via targeting the IGF1R/k-Ras/Raf/MEK/ERK signaling pathway
title_full MicroRNA-98 suppresses cell growth and invasion of retinoblastoma via targeting the IGF1R/k-Ras/Raf/MEK/ERK signaling pathway
title_fullStr MicroRNA-98 suppresses cell growth and invasion of retinoblastoma via targeting the IGF1R/k-Ras/Raf/MEK/ERK signaling pathway
title_full_unstemmed MicroRNA-98 suppresses cell growth and invasion of retinoblastoma via targeting the IGF1R/k-Ras/Raf/MEK/ERK signaling pathway
title_short MicroRNA-98 suppresses cell growth and invasion of retinoblastoma via targeting the IGF1R/k-Ras/Raf/MEK/ERK signaling pathway
title_sort microrna-98 suppresses cell growth and invasion of retinoblastoma via targeting the igf1r/k-ras/raf/mek/erk signaling pathway
topic Articles
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6365030/
https://www.ncbi.nlm.nih.gov/pubmed/30664191
http://dx.doi.org/10.3892/ijo.2019.4689
work_keys_str_mv AT guolong microrna98suppressescellgrowthandinvasionofretinoblastomaviatargetingtheigf1rkrasrafmekerksignalingpathway
AT baiyu microrna98suppressescellgrowthandinvasionofretinoblastomaviatargetingtheigf1rkrasrafmekerksignalingpathway
AT jishuzhe microrna98suppressescellgrowthandinvasionofretinoblastomaviatargetingtheigf1rkrasrafmekerksignalingpathway
AT mahong microrna98suppressescellgrowthandinvasionofretinoblastomaviatargetingtheigf1rkrasrafmekerksignalingpathway