Cargando…

Comparison of osteogenic differentiation capacity in mesenchymal stem cells derived from human amniotic membrane (AM), umbilical cord (UC), chorionic membrane (CM), and decidua (DC)

BACKGROUND: Mesenchymal stem cells (MSCs) have been extensively explored as a promising therapeutic agent in the field of bone tissue engineering due to their osteogenic differentiation ability. In this study, the osteogenic differential ability and the effect of fibronectin and laminin on the osteo...

Descripción completa

Detalles Bibliográficos
Autores principales: Shen, Chongyang, Yang, Chuan, Xu, Shijun, Zhao, Hai
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6371545/
https://www.ncbi.nlm.nih.gov/pubmed/30792848
http://dx.doi.org/10.1186/s13578-019-0281-3
_version_ 1783394574000979968
author Shen, Chongyang
Yang, Chuan
Xu, Shijun
Zhao, Hai
author_facet Shen, Chongyang
Yang, Chuan
Xu, Shijun
Zhao, Hai
author_sort Shen, Chongyang
collection PubMed
description BACKGROUND: Mesenchymal stem cells (MSCs) have been extensively explored as a promising therapeutic agent in the field of bone tissue engineering due to their osteogenic differentiation ability. In this study, the osteogenic differential ability and the effect of fibronectin and laminin on the osteogenic differentiation in four types of MSCs derived from placental tissue are compared to determine the ideal source for bone reconstruction tissue engineering. RESULTS: The present study examines the osteogenic differentiation levels of four types of MSCs using alizarin red staining and quantifies the calcium levels and alkaline phosphatase (ALP) activity. In addition, this study examines the osteoblast differentiation protein markers osterix, collagen I, osteopontin, and osteocalcin using a Western blot assay. qPCR and EdU labeling assays were employed to identify the kinetics of osteogenic differentiation. Calcium deposit levels, ALP activity, and osteopontin and osteocalcin concentrations were determined to confirm the role of Extracellular matrix (ECM) components role on the osteogenic differentiation of MSCs. The data demonstrated that MSCs isolated from different layers of placenta had different potentials to differentiate into osteogenic cells. Importantly, AM-MSCs and UC-MSCs differentiated into the osteoblast stage more efficiently and quickly than CM-MSCs and DC-MSCs, which was associated with a decrease in their proliferation ability. Among the different types of MSCs, AM-MSCs and UC-MSCs had a higher osteogenic differentiation potential induced by fibronectin due to enhanced phosphorylation during the Akt and ERK pathways. CONCLUSIONS: Taken together, these results indicate that AM-MSCs and UC-MSCs possess a higher osteogenic potential, and fibronectin can robustly enhance the osteogenic potential of the Akt and ERK pathways. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13578-019-0281-3) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-6371545
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-63715452019-02-21 Comparison of osteogenic differentiation capacity in mesenchymal stem cells derived from human amniotic membrane (AM), umbilical cord (UC), chorionic membrane (CM), and decidua (DC) Shen, Chongyang Yang, Chuan Xu, Shijun Zhao, Hai Cell Biosci Research BACKGROUND: Mesenchymal stem cells (MSCs) have been extensively explored as a promising therapeutic agent in the field of bone tissue engineering due to their osteogenic differentiation ability. In this study, the osteogenic differential ability and the effect of fibronectin and laminin on the osteogenic differentiation in four types of MSCs derived from placental tissue are compared to determine the ideal source for bone reconstruction tissue engineering. RESULTS: The present study examines the osteogenic differentiation levels of four types of MSCs using alizarin red staining and quantifies the calcium levels and alkaline phosphatase (ALP) activity. In addition, this study examines the osteoblast differentiation protein markers osterix, collagen I, osteopontin, and osteocalcin using a Western blot assay. qPCR and EdU labeling assays were employed to identify the kinetics of osteogenic differentiation. Calcium deposit levels, ALP activity, and osteopontin and osteocalcin concentrations were determined to confirm the role of Extracellular matrix (ECM) components role on the osteogenic differentiation of MSCs. The data demonstrated that MSCs isolated from different layers of placenta had different potentials to differentiate into osteogenic cells. Importantly, AM-MSCs and UC-MSCs differentiated into the osteoblast stage more efficiently and quickly than CM-MSCs and DC-MSCs, which was associated with a decrease in their proliferation ability. Among the different types of MSCs, AM-MSCs and UC-MSCs had a higher osteogenic differentiation potential induced by fibronectin due to enhanced phosphorylation during the Akt and ERK pathways. CONCLUSIONS: Taken together, these results indicate that AM-MSCs and UC-MSCs possess a higher osteogenic potential, and fibronectin can robustly enhance the osteogenic potential of the Akt and ERK pathways. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13578-019-0281-3) contains supplementary material, which is available to authorized users. BioMed Central 2019-02-11 /pmc/articles/PMC6371545/ /pubmed/30792848 http://dx.doi.org/10.1186/s13578-019-0281-3 Text en © The Author(s) 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research
Shen, Chongyang
Yang, Chuan
Xu, Shijun
Zhao, Hai
Comparison of osteogenic differentiation capacity in mesenchymal stem cells derived from human amniotic membrane (AM), umbilical cord (UC), chorionic membrane (CM), and decidua (DC)
title Comparison of osteogenic differentiation capacity in mesenchymal stem cells derived from human amniotic membrane (AM), umbilical cord (UC), chorionic membrane (CM), and decidua (DC)
title_full Comparison of osteogenic differentiation capacity in mesenchymal stem cells derived from human amniotic membrane (AM), umbilical cord (UC), chorionic membrane (CM), and decidua (DC)
title_fullStr Comparison of osteogenic differentiation capacity in mesenchymal stem cells derived from human amniotic membrane (AM), umbilical cord (UC), chorionic membrane (CM), and decidua (DC)
title_full_unstemmed Comparison of osteogenic differentiation capacity in mesenchymal stem cells derived from human amniotic membrane (AM), umbilical cord (UC), chorionic membrane (CM), and decidua (DC)
title_short Comparison of osteogenic differentiation capacity in mesenchymal stem cells derived from human amniotic membrane (AM), umbilical cord (UC), chorionic membrane (CM), and decidua (DC)
title_sort comparison of osteogenic differentiation capacity in mesenchymal stem cells derived from human amniotic membrane (am), umbilical cord (uc), chorionic membrane (cm), and decidua (dc)
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6371545/
https://www.ncbi.nlm.nih.gov/pubmed/30792848
http://dx.doi.org/10.1186/s13578-019-0281-3
work_keys_str_mv AT shenchongyang comparisonofosteogenicdifferentiationcapacityinmesenchymalstemcellsderivedfromhumanamnioticmembraneamumbilicalcorducchorionicmembranecmanddeciduadc
AT yangchuan comparisonofosteogenicdifferentiationcapacityinmesenchymalstemcellsderivedfromhumanamnioticmembraneamumbilicalcorducchorionicmembranecmanddeciduadc
AT xushijun comparisonofosteogenicdifferentiationcapacityinmesenchymalstemcellsderivedfromhumanamnioticmembraneamumbilicalcorducchorionicmembranecmanddeciduadc
AT zhaohai comparisonofosteogenicdifferentiationcapacityinmesenchymalstemcellsderivedfromhumanamnioticmembraneamumbilicalcorducchorionicmembranecmanddeciduadc