Cargando…
Comparison of CPG’s for the diagnosis, prognosis and management of non-specific neck pain: a systematic review
BACKGROUND: Neck pain (NP) is a very common musculoskeletal condition with potential for a high burden in disability and length of disorder. Clinical practice guidelines (CPG) give recommendations to clinicians for providing optimal care for patients however best practice recommendations are often c...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6376764/ https://www.ncbi.nlm.nih.gov/pubmed/30764789 http://dx.doi.org/10.1186/s12891-019-2441-3 |
_version_ | 1783395633904746496 |
---|---|
author | Parikh, Pulak Santaguida, Pasqualina Macdermid, Joy Gross, Anita Eshtiaghi, Arshia |
author_facet | Parikh, Pulak Santaguida, Pasqualina Macdermid, Joy Gross, Anita Eshtiaghi, Arshia |
author_sort | Parikh, Pulak |
collection | PubMed |
description | BACKGROUND: Neck pain (NP) is a very common musculoskeletal condition with potential for a high burden in disability and length of disorder. Clinical practice guidelines (CPG) give recommendations to clinicians for providing optimal care for patients however best practice recommendations are often contradictory. The purpose for this review was to conduct a SR of CPGs to assess the management recommendations for NP (diagnosis, treatment, prognosis, imaging). METHODS: Standard SR methodology was employed including a grey literature search (including the National Guideline Clearing House). Medline, Cinahl, Embase, ILC, Cochrane, Central, and Lilacs were searched from 1995-to March 2018. Two raters evaluated all citations and a third rater resolved any disagreements. The AGREE II was used to assess risk of bias of each CPG. Data was extracted and included CPG purpose, type of NP problem and clinical recommendations. The AGREE II critical appraisal tool was used to assess risk of bias of each CPG. RESULTS: From 640 articles, 241 were available for screening. A total of 46 guidelines were selected. CPG’s were categorized by the NP population (General NP, whiplash, interventional, headache and risk for vertebral insufficiency) and type of clinical aim (diagnosis, prognosis, treatment, imaging). Each clinical NP population had a large overlap of clinical aims presented. The CPGs were directed to a variety of clinicians that included physicians, physiotherapists and chiropractors. Results suggest heterogeneity in CPG recommendations within each clinical aim. CPG characteristics accounting for these differences are outlined. CONCLUSION: The majority of CPGs were developed for general NP that focused on treatment recommendations, with fewer number aimed at recommendations for diagnosis, prognosis, and outcomes. Heterogeneity of recommendations within the categories were noted as were potential factors associated with these differences, including CPG quality as assessed by the AGREE II. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12891-019-2441-3) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-6376764 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-63767642019-02-27 Comparison of CPG’s for the diagnosis, prognosis and management of non-specific neck pain: a systematic review Parikh, Pulak Santaguida, Pasqualina Macdermid, Joy Gross, Anita Eshtiaghi, Arshia BMC Musculoskelet Disord Research Article BACKGROUND: Neck pain (NP) is a very common musculoskeletal condition with potential for a high burden in disability and length of disorder. Clinical practice guidelines (CPG) give recommendations to clinicians for providing optimal care for patients however best practice recommendations are often contradictory. The purpose for this review was to conduct a SR of CPGs to assess the management recommendations for NP (diagnosis, treatment, prognosis, imaging). METHODS: Standard SR methodology was employed including a grey literature search (including the National Guideline Clearing House). Medline, Cinahl, Embase, ILC, Cochrane, Central, and Lilacs were searched from 1995-to March 2018. Two raters evaluated all citations and a third rater resolved any disagreements. The AGREE II was used to assess risk of bias of each CPG. Data was extracted and included CPG purpose, type of NP problem and clinical recommendations. The AGREE II critical appraisal tool was used to assess risk of bias of each CPG. RESULTS: From 640 articles, 241 were available for screening. A total of 46 guidelines were selected. CPG’s were categorized by the NP population (General NP, whiplash, interventional, headache and risk for vertebral insufficiency) and type of clinical aim (diagnosis, prognosis, treatment, imaging). Each clinical NP population had a large overlap of clinical aims presented. The CPGs were directed to a variety of clinicians that included physicians, physiotherapists and chiropractors. Results suggest heterogeneity in CPG recommendations within each clinical aim. CPG characteristics accounting for these differences are outlined. CONCLUSION: The majority of CPGs were developed for general NP that focused on treatment recommendations, with fewer number aimed at recommendations for diagnosis, prognosis, and outcomes. Heterogeneity of recommendations within the categories were noted as were potential factors associated with these differences, including CPG quality as assessed by the AGREE II. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12891-019-2441-3) contains supplementary material, which is available to authorized users. BioMed Central 2019-02-14 /pmc/articles/PMC6376764/ /pubmed/30764789 http://dx.doi.org/10.1186/s12891-019-2441-3 Text en © The Author(s). 2019 Open Access This article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Parikh, Pulak Santaguida, Pasqualina Macdermid, Joy Gross, Anita Eshtiaghi, Arshia Comparison of CPG’s for the diagnosis, prognosis and management of non-specific neck pain: a systematic review |
title | Comparison of CPG’s for the diagnosis, prognosis and management of non-specific neck pain: a systematic review |
title_full | Comparison of CPG’s for the diagnosis, prognosis and management of non-specific neck pain: a systematic review |
title_fullStr | Comparison of CPG’s for the diagnosis, prognosis and management of non-specific neck pain: a systematic review |
title_full_unstemmed | Comparison of CPG’s for the diagnosis, prognosis and management of non-specific neck pain: a systematic review |
title_short | Comparison of CPG’s for the diagnosis, prognosis and management of non-specific neck pain: a systematic review |
title_sort | comparison of cpg’s for the diagnosis, prognosis and management of non-specific neck pain: a systematic review |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6376764/ https://www.ncbi.nlm.nih.gov/pubmed/30764789 http://dx.doi.org/10.1186/s12891-019-2441-3 |
work_keys_str_mv | AT parikhpulak comparisonofcpgsforthediagnosisprognosisandmanagementofnonspecificneckpainasystematicreview AT santaguidapasqualina comparisonofcpgsforthediagnosisprognosisandmanagementofnonspecificneckpainasystematicreview AT macdermidjoy comparisonofcpgsforthediagnosisprognosisandmanagementofnonspecificneckpainasystematicreview AT grossanita comparisonofcpgsforthediagnosisprognosisandmanagementofnonspecificneckpainasystematicreview AT eshtiaghiarshia comparisonofcpgsforthediagnosisprognosisandmanagementofnonspecificneckpainasystematicreview |