Cargando…
Effects of placebo on bench throw performance of Paralympic weightlifting athletes: a pilot study
BACKGROUND: The aim of the present study was to analyse the effects of placebo on bench throw performance in Paralympic weightlifting athletes. METHODS: The study involved four Paralympic weightlifting male athletes (age: 40.25 ± 9.91 years, weight: 60.5 ± 8.29 kg, height: 1.60 ± 0.15 m) that visite...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6381705/ https://www.ncbi.nlm.nih.gov/pubmed/30782172 http://dx.doi.org/10.1186/s12970-019-0276-9 |
_version_ | 1783396555145871360 |
---|---|
author | Costa, Gustavo De Conti Teixeira Galvão, Luan Bottaro, Martim Mota, João Felipe Pimentel, Gustavo Duarte Gentil, Paulo |
author_facet | Costa, Gustavo De Conti Teixeira Galvão, Luan Bottaro, Martim Mota, João Felipe Pimentel, Gustavo Duarte Gentil, Paulo |
author_sort | Costa, Gustavo De Conti Teixeira |
collection | PubMed |
description | BACKGROUND: The aim of the present study was to analyse the effects of placebo on bench throw performance in Paralympic weightlifting athletes. METHODS: The study involved four Paralympic weightlifting male athletes (age: 40.25 ± 9.91 years, weight: 60.5 ± 8.29 kg, height: 1.60 ± 0.15 m) that visited the laboratory in three occasions, separated by 72 h. In the first session, the athletes were tested for bench press one repetition maximum (1RM). The other two sessions were performed in a randomized counter-balanced order and involved bench throw tests performed either after taking placebo while being informed that the capsule contained caffeine or without taking any substance (control). The bench throw tests were performed with loads corresponding to 50, 60, 70 and 80% of the bench press 1RM. RESULTS: According to the results, mean velocity (∆: 0.08 m/s, ES 0.36, p < 0.05) and mean propulsive velocity (∆: 0.11 m/s, ES 0.49, p < 0.05) at 50% of 1RM were significantly higher during placebo than control (p < 0.05). However, there were no difference between control and placebo for 60, 70 and 80% of 1RM (p > 0.05). CONCLUSION: Our results suggest that placebo intake, when the athletes were informed they were taking caffeine, might be an efficient strategy to improve the performance of explosive movements in Paralympic weightlifting athletes when using low-loads. This brings the possibility of using placebo in order to increase performance, which might reduce the risks associated with ergogenic aids, such as side-effects and positive doping testing. |
format | Online Article Text |
id | pubmed-6381705 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-63817052019-03-01 Effects of placebo on bench throw performance of Paralympic weightlifting athletes: a pilot study Costa, Gustavo De Conti Teixeira Galvão, Luan Bottaro, Martim Mota, João Felipe Pimentel, Gustavo Duarte Gentil, Paulo J Int Soc Sports Nutr Research Article BACKGROUND: The aim of the present study was to analyse the effects of placebo on bench throw performance in Paralympic weightlifting athletes. METHODS: The study involved four Paralympic weightlifting male athletes (age: 40.25 ± 9.91 years, weight: 60.5 ± 8.29 kg, height: 1.60 ± 0.15 m) that visited the laboratory in three occasions, separated by 72 h. In the first session, the athletes were tested for bench press one repetition maximum (1RM). The other two sessions were performed in a randomized counter-balanced order and involved bench throw tests performed either after taking placebo while being informed that the capsule contained caffeine or without taking any substance (control). The bench throw tests were performed with loads corresponding to 50, 60, 70 and 80% of the bench press 1RM. RESULTS: According to the results, mean velocity (∆: 0.08 m/s, ES 0.36, p < 0.05) and mean propulsive velocity (∆: 0.11 m/s, ES 0.49, p < 0.05) at 50% of 1RM were significantly higher during placebo than control (p < 0.05). However, there were no difference between control and placebo for 60, 70 and 80% of 1RM (p > 0.05). CONCLUSION: Our results suggest that placebo intake, when the athletes were informed they were taking caffeine, might be an efficient strategy to improve the performance of explosive movements in Paralympic weightlifting athletes when using low-loads. This brings the possibility of using placebo in order to increase performance, which might reduce the risks associated with ergogenic aids, such as side-effects and positive doping testing. BioMed Central 2019-02-19 /pmc/articles/PMC6381705/ /pubmed/30782172 http://dx.doi.org/10.1186/s12970-019-0276-9 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Costa, Gustavo De Conti Teixeira Galvão, Luan Bottaro, Martim Mota, João Felipe Pimentel, Gustavo Duarte Gentil, Paulo Effects of placebo on bench throw performance of Paralympic weightlifting athletes: a pilot study |
title | Effects of placebo on bench throw performance of Paralympic weightlifting athletes: a pilot study |
title_full | Effects of placebo on bench throw performance of Paralympic weightlifting athletes: a pilot study |
title_fullStr | Effects of placebo on bench throw performance of Paralympic weightlifting athletes: a pilot study |
title_full_unstemmed | Effects of placebo on bench throw performance of Paralympic weightlifting athletes: a pilot study |
title_short | Effects of placebo on bench throw performance of Paralympic weightlifting athletes: a pilot study |
title_sort | effects of placebo on bench throw performance of paralympic weightlifting athletes: a pilot study |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6381705/ https://www.ncbi.nlm.nih.gov/pubmed/30782172 http://dx.doi.org/10.1186/s12970-019-0276-9 |
work_keys_str_mv | AT costagustavodecontiteixeira effectsofplaceboonbenchthrowperformanceofparalympicweightliftingathletesapilotstudy AT galvaoluan effectsofplaceboonbenchthrowperformanceofparalympicweightliftingathletesapilotstudy AT bottaromartim effectsofplaceboonbenchthrowperformanceofparalympicweightliftingathletesapilotstudy AT motajoaofelipe effectsofplaceboonbenchthrowperformanceofparalympicweightliftingathletesapilotstudy AT pimentelgustavoduarte effectsofplaceboonbenchthrowperformanceofparalympicweightliftingathletesapilotstudy AT gentilpaulo effectsofplaceboonbenchthrowperformanceofparalympicweightliftingathletesapilotstudy |