Cargando…
Chronic visceral acid sphingomyelinase deficiency (Niemann-Pick disease type B) in 16 Polish patients: long-term follow-up
BACKGROUND: Acid sphingomyelinase deficiency (ASMD), due to mutations in the sphingomyelin phosphodiesterase 1 (SMPD1) gene, is divided into infantile neurovisceral ASMD (Niemann-Pick type A), chronic neurovisceral ASMD (intermediate form, Niemann-Pick type A/B) and chronic visceral ASMD (Niemann-Pi...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6387484/ https://www.ncbi.nlm.nih.gov/pubmed/30795770 http://dx.doi.org/10.1186/s13023-019-1029-1 |
_version_ | 1783397592202215424 |
---|---|
author | Lipiński, Patryk Kuchar, Ladislav Zakharova, Ekaterina Y. Baydakova, Galina V. Ługowska, Agnieszka Tylki-Szymańska, Anna |
author_facet | Lipiński, Patryk Kuchar, Ladislav Zakharova, Ekaterina Y. Baydakova, Galina V. Ługowska, Agnieszka Tylki-Szymańska, Anna |
author_sort | Lipiński, Patryk |
collection | PubMed |
description | BACKGROUND: Acid sphingomyelinase deficiency (ASMD), due to mutations in the sphingomyelin phosphodiesterase 1 (SMPD1) gene, is divided into infantile neurovisceral ASMD (Niemann-Pick type A), chronic neurovisceral ASMD (intermediate form, Niemann-Pick type A/B) and chronic visceral ASMD (Niemann-Pick type B). We conducted a long-term observational, single-center study including 16 patients with chronic visceral ASMD. RESULTS: 12 patients were diagnosed in childhood and 4 others in adulthood, the oldest at the age of 50. The mean time of follow-up was approximately 10 years (range: 6 months – 36 years). Splenomegaly was noted in all patients at diagnosis. Hepatomegaly was observed in 88% of patients. Moderately elevated (several-fold above the upper limit of normal values) serum transaminases were noted in 38% of patients. Cherry-red spots were found in five Gypsy children from one family and also in one adult Polish patient, a heterozygote for p.delR610 mutation. Dyslipidemia was noted in 50% of patients. Interstitial lung disease was diagnosed in 44% of patients. Plasmatic lysosphingomyelin (SPC) was elevated in all the patients except one with p.V36A homozygosity and a very mild phenotype also presenting with elevated plasmatic SPC-509 but normal chitotriosidase activity. The most common variant of SMPD1 gene was p.G166R. We found a previously unreported variant in exon 2 (c.491G > T, p.G164 V) in one patient. CONCLUSIONS: Chronic visceral ASMD could constitute a slowly progressing disease with a relatively good outcome. The combined measurement of lysosphingomyelin (SPC) and lysospingomyelin-509 (SPC-509) is an essential method for the assessment of ASMD course. |
format | Online Article Text |
id | pubmed-6387484 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-63874842019-03-04 Chronic visceral acid sphingomyelinase deficiency (Niemann-Pick disease type B) in 16 Polish patients: long-term follow-up Lipiński, Patryk Kuchar, Ladislav Zakharova, Ekaterina Y. Baydakova, Galina V. Ługowska, Agnieszka Tylki-Szymańska, Anna Orphanet J Rare Dis Research BACKGROUND: Acid sphingomyelinase deficiency (ASMD), due to mutations in the sphingomyelin phosphodiesterase 1 (SMPD1) gene, is divided into infantile neurovisceral ASMD (Niemann-Pick type A), chronic neurovisceral ASMD (intermediate form, Niemann-Pick type A/B) and chronic visceral ASMD (Niemann-Pick type B). We conducted a long-term observational, single-center study including 16 patients with chronic visceral ASMD. RESULTS: 12 patients were diagnosed in childhood and 4 others in adulthood, the oldest at the age of 50. The mean time of follow-up was approximately 10 years (range: 6 months – 36 years). Splenomegaly was noted in all patients at diagnosis. Hepatomegaly was observed in 88% of patients. Moderately elevated (several-fold above the upper limit of normal values) serum transaminases were noted in 38% of patients. Cherry-red spots were found in five Gypsy children from one family and also in one adult Polish patient, a heterozygote for p.delR610 mutation. Dyslipidemia was noted in 50% of patients. Interstitial lung disease was diagnosed in 44% of patients. Plasmatic lysosphingomyelin (SPC) was elevated in all the patients except one with p.V36A homozygosity and a very mild phenotype also presenting with elevated plasmatic SPC-509 but normal chitotriosidase activity. The most common variant of SMPD1 gene was p.G166R. We found a previously unreported variant in exon 2 (c.491G > T, p.G164 V) in one patient. CONCLUSIONS: Chronic visceral ASMD could constitute a slowly progressing disease with a relatively good outcome. The combined measurement of lysosphingomyelin (SPC) and lysospingomyelin-509 (SPC-509) is an essential method for the assessment of ASMD course. BioMed Central 2019-02-22 /pmc/articles/PMC6387484/ /pubmed/30795770 http://dx.doi.org/10.1186/s13023-019-1029-1 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Lipiński, Patryk Kuchar, Ladislav Zakharova, Ekaterina Y. Baydakova, Galina V. Ługowska, Agnieszka Tylki-Szymańska, Anna Chronic visceral acid sphingomyelinase deficiency (Niemann-Pick disease type B) in 16 Polish patients: long-term follow-up |
title | Chronic visceral acid sphingomyelinase deficiency (Niemann-Pick disease type B) in 16 Polish patients: long-term follow-up |
title_full | Chronic visceral acid sphingomyelinase deficiency (Niemann-Pick disease type B) in 16 Polish patients: long-term follow-up |
title_fullStr | Chronic visceral acid sphingomyelinase deficiency (Niemann-Pick disease type B) in 16 Polish patients: long-term follow-up |
title_full_unstemmed | Chronic visceral acid sphingomyelinase deficiency (Niemann-Pick disease type B) in 16 Polish patients: long-term follow-up |
title_short | Chronic visceral acid sphingomyelinase deficiency (Niemann-Pick disease type B) in 16 Polish patients: long-term follow-up |
title_sort | chronic visceral acid sphingomyelinase deficiency (niemann-pick disease type b) in 16 polish patients: long-term follow-up |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6387484/ https://www.ncbi.nlm.nih.gov/pubmed/30795770 http://dx.doi.org/10.1186/s13023-019-1029-1 |
work_keys_str_mv | AT lipinskipatryk chronicvisceralacidsphingomyelinasedeficiencyniemannpickdiseasetypebin16polishpatientslongtermfollowup AT kucharladislav chronicvisceralacidsphingomyelinasedeficiencyniemannpickdiseasetypebin16polishpatientslongtermfollowup AT zakharovaekaterinay chronicvisceralacidsphingomyelinasedeficiencyniemannpickdiseasetypebin16polishpatientslongtermfollowup AT baydakovagalinav chronicvisceralacidsphingomyelinasedeficiencyniemannpickdiseasetypebin16polishpatientslongtermfollowup AT ługowskaagnieszka chronicvisceralacidsphingomyelinasedeficiencyniemannpickdiseasetypebin16polishpatientslongtermfollowup AT tylkiszymanskaanna chronicvisceralacidsphingomyelinasedeficiencyniemannpickdiseasetypebin16polishpatientslongtermfollowup |