Cargando…

Nasal mucus glutathione transferase activity and impact on olfactory perception and neonatal behavior

In olfaction, to preserve the sensitivity of the response, the bioavailability of odor molecules is under the control of odorant-metabolizing enzymes (OMEs) expressed in the olfactory neuroepithelium. Although this enzymatic regulation has been shown to be involved in olfactory receptor activation a...

Descripción completa

Detalles Bibliográficos
Autores principales: Robert-Hazotte, Aline, Faure, Philippe, Neiers, Fabrice, Potin, Catherine, Artur, Yves, Coureaud, Gérard, Heydel, Jean-Marie
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Nature Publishing Group UK 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6395716/
https://www.ncbi.nlm.nih.gov/pubmed/30816217
http://dx.doi.org/10.1038/s41598-019-39495-6
_version_ 1783399133551263744
author Robert-Hazotte, Aline
Faure, Philippe
Neiers, Fabrice
Potin, Catherine
Artur, Yves
Coureaud, Gérard
Heydel, Jean-Marie
author_facet Robert-Hazotte, Aline
Faure, Philippe
Neiers, Fabrice
Potin, Catherine
Artur, Yves
Coureaud, Gérard
Heydel, Jean-Marie
author_sort Robert-Hazotte, Aline
collection PubMed
description In olfaction, to preserve the sensitivity of the response, the bioavailability of odor molecules is under the control of odorant-metabolizing enzymes (OMEs) expressed in the olfactory neuroepithelium. Although this enzymatic regulation has been shown to be involved in olfactory receptor activation and perceptual responses, it remains widely underestimated in vertebrates. In particular, the possible activity of OMEs in the nasal mucus, i.e. the aqueous layer that lined the nasal epithelium and forms the interface for airborne odorants to reach the olfactory sensory neurons, is poorly known. Here, we used the well-described model of the mammary pheromone (MP) and behavioral response in rabbit neonates to challenge the function of nasal mucus metabolism in an unprecedented way. First, we showed, in the olfactory epithelium, a rapid glutathione transferase activity toward the MP by ex vivo real-time mass spectrometry (PTR-MS) which supported an activity in the closest vicinity of both the odorants and olfactory receptors. Indeed and second, both the presence and activity of glutathione transferases were evidenced in the nasal mucus of neonates using proteomic and HPLC analysis respectively. Finally, we strikingly demonstrated that the deregulation of the MP metabolism by in vivo mucus washing modulates the newborn rabbit behavioral responsiveness to the MP. This is a step forward in the demonstration of the critical function of OMEs especially in the mucus, which is at the nasal front line of interaction with odorants and potentially subjected to physiopathological changes.
format Online
Article
Text
id pubmed-6395716
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher Nature Publishing Group UK
record_format MEDLINE/PubMed
spelling pubmed-63957162019-03-04 Nasal mucus glutathione transferase activity and impact on olfactory perception and neonatal behavior Robert-Hazotte, Aline Faure, Philippe Neiers, Fabrice Potin, Catherine Artur, Yves Coureaud, Gérard Heydel, Jean-Marie Sci Rep Article In olfaction, to preserve the sensitivity of the response, the bioavailability of odor molecules is under the control of odorant-metabolizing enzymes (OMEs) expressed in the olfactory neuroepithelium. Although this enzymatic regulation has been shown to be involved in olfactory receptor activation and perceptual responses, it remains widely underestimated in vertebrates. In particular, the possible activity of OMEs in the nasal mucus, i.e. the aqueous layer that lined the nasal epithelium and forms the interface for airborne odorants to reach the olfactory sensory neurons, is poorly known. Here, we used the well-described model of the mammary pheromone (MP) and behavioral response in rabbit neonates to challenge the function of nasal mucus metabolism in an unprecedented way. First, we showed, in the olfactory epithelium, a rapid glutathione transferase activity toward the MP by ex vivo real-time mass spectrometry (PTR-MS) which supported an activity in the closest vicinity of both the odorants and olfactory receptors. Indeed and second, both the presence and activity of glutathione transferases were evidenced in the nasal mucus of neonates using proteomic and HPLC analysis respectively. Finally, we strikingly demonstrated that the deregulation of the MP metabolism by in vivo mucus washing modulates the newborn rabbit behavioral responsiveness to the MP. This is a step forward in the demonstration of the critical function of OMEs especially in the mucus, which is at the nasal front line of interaction with odorants and potentially subjected to physiopathological changes. Nature Publishing Group UK 2019-02-28 /pmc/articles/PMC6395716/ /pubmed/30816217 http://dx.doi.org/10.1038/s41598-019-39495-6 Text en © The Author(s) 2019 Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/.
spellingShingle Article
Robert-Hazotte, Aline
Faure, Philippe
Neiers, Fabrice
Potin, Catherine
Artur, Yves
Coureaud, Gérard
Heydel, Jean-Marie
Nasal mucus glutathione transferase activity and impact on olfactory perception and neonatal behavior
title Nasal mucus glutathione transferase activity and impact on olfactory perception and neonatal behavior
title_full Nasal mucus glutathione transferase activity and impact on olfactory perception and neonatal behavior
title_fullStr Nasal mucus glutathione transferase activity and impact on olfactory perception and neonatal behavior
title_full_unstemmed Nasal mucus glutathione transferase activity and impact on olfactory perception and neonatal behavior
title_short Nasal mucus glutathione transferase activity and impact on olfactory perception and neonatal behavior
title_sort nasal mucus glutathione transferase activity and impact on olfactory perception and neonatal behavior
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6395716/
https://www.ncbi.nlm.nih.gov/pubmed/30816217
http://dx.doi.org/10.1038/s41598-019-39495-6
work_keys_str_mv AT roberthazottealine nasalmucusglutathionetransferaseactivityandimpactonolfactoryperceptionandneonatalbehavior
AT faurephilippe nasalmucusglutathionetransferaseactivityandimpactonolfactoryperceptionandneonatalbehavior
AT neiersfabrice nasalmucusglutathionetransferaseactivityandimpactonolfactoryperceptionandneonatalbehavior
AT potincatherine nasalmucusglutathionetransferaseactivityandimpactonolfactoryperceptionandneonatalbehavior
AT arturyves nasalmucusglutathionetransferaseactivityandimpactonolfactoryperceptionandneonatalbehavior
AT coureaudgerard nasalmucusglutathionetransferaseactivityandimpactonolfactoryperceptionandneonatalbehavior
AT heydeljeanmarie nasalmucusglutathionetransferaseactivityandimpactonolfactoryperceptionandneonatalbehavior