Cargando…
Nasal mucus glutathione transferase activity and impact on olfactory perception and neonatal behavior
In olfaction, to preserve the sensitivity of the response, the bioavailability of odor molecules is under the control of odorant-metabolizing enzymes (OMEs) expressed in the olfactory neuroepithelium. Although this enzymatic regulation has been shown to be involved in olfactory receptor activation a...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group UK
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6395716/ https://www.ncbi.nlm.nih.gov/pubmed/30816217 http://dx.doi.org/10.1038/s41598-019-39495-6 |
_version_ | 1783399133551263744 |
---|---|
author | Robert-Hazotte, Aline Faure, Philippe Neiers, Fabrice Potin, Catherine Artur, Yves Coureaud, Gérard Heydel, Jean-Marie |
author_facet | Robert-Hazotte, Aline Faure, Philippe Neiers, Fabrice Potin, Catherine Artur, Yves Coureaud, Gérard Heydel, Jean-Marie |
author_sort | Robert-Hazotte, Aline |
collection | PubMed |
description | In olfaction, to preserve the sensitivity of the response, the bioavailability of odor molecules is under the control of odorant-metabolizing enzymes (OMEs) expressed in the olfactory neuroepithelium. Although this enzymatic regulation has been shown to be involved in olfactory receptor activation and perceptual responses, it remains widely underestimated in vertebrates. In particular, the possible activity of OMEs in the nasal mucus, i.e. the aqueous layer that lined the nasal epithelium and forms the interface for airborne odorants to reach the olfactory sensory neurons, is poorly known. Here, we used the well-described model of the mammary pheromone (MP) and behavioral response in rabbit neonates to challenge the function of nasal mucus metabolism in an unprecedented way. First, we showed, in the olfactory epithelium, a rapid glutathione transferase activity toward the MP by ex vivo real-time mass spectrometry (PTR-MS) which supported an activity in the closest vicinity of both the odorants and olfactory receptors. Indeed and second, both the presence and activity of glutathione transferases were evidenced in the nasal mucus of neonates using proteomic and HPLC analysis respectively. Finally, we strikingly demonstrated that the deregulation of the MP metabolism by in vivo mucus washing modulates the newborn rabbit behavioral responsiveness to the MP. This is a step forward in the demonstration of the critical function of OMEs especially in the mucus, which is at the nasal front line of interaction with odorants and potentially subjected to physiopathological changes. |
format | Online Article Text |
id | pubmed-6395716 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | Nature Publishing Group UK |
record_format | MEDLINE/PubMed |
spelling | pubmed-63957162019-03-04 Nasal mucus glutathione transferase activity and impact on olfactory perception and neonatal behavior Robert-Hazotte, Aline Faure, Philippe Neiers, Fabrice Potin, Catherine Artur, Yves Coureaud, Gérard Heydel, Jean-Marie Sci Rep Article In olfaction, to preserve the sensitivity of the response, the bioavailability of odor molecules is under the control of odorant-metabolizing enzymes (OMEs) expressed in the olfactory neuroepithelium. Although this enzymatic regulation has been shown to be involved in olfactory receptor activation and perceptual responses, it remains widely underestimated in vertebrates. In particular, the possible activity of OMEs in the nasal mucus, i.e. the aqueous layer that lined the nasal epithelium and forms the interface for airborne odorants to reach the olfactory sensory neurons, is poorly known. Here, we used the well-described model of the mammary pheromone (MP) and behavioral response in rabbit neonates to challenge the function of nasal mucus metabolism in an unprecedented way. First, we showed, in the olfactory epithelium, a rapid glutathione transferase activity toward the MP by ex vivo real-time mass spectrometry (PTR-MS) which supported an activity in the closest vicinity of both the odorants and olfactory receptors. Indeed and second, both the presence and activity of glutathione transferases were evidenced in the nasal mucus of neonates using proteomic and HPLC analysis respectively. Finally, we strikingly demonstrated that the deregulation of the MP metabolism by in vivo mucus washing modulates the newborn rabbit behavioral responsiveness to the MP. This is a step forward in the demonstration of the critical function of OMEs especially in the mucus, which is at the nasal front line of interaction with odorants and potentially subjected to physiopathological changes. Nature Publishing Group UK 2019-02-28 /pmc/articles/PMC6395716/ /pubmed/30816217 http://dx.doi.org/10.1038/s41598-019-39495-6 Text en © The Author(s) 2019 Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/. |
spellingShingle | Article Robert-Hazotte, Aline Faure, Philippe Neiers, Fabrice Potin, Catherine Artur, Yves Coureaud, Gérard Heydel, Jean-Marie Nasal mucus glutathione transferase activity and impact on olfactory perception and neonatal behavior |
title | Nasal mucus glutathione transferase activity and impact on olfactory perception and neonatal behavior |
title_full | Nasal mucus glutathione transferase activity and impact on olfactory perception and neonatal behavior |
title_fullStr | Nasal mucus glutathione transferase activity and impact on olfactory perception and neonatal behavior |
title_full_unstemmed | Nasal mucus glutathione transferase activity and impact on olfactory perception and neonatal behavior |
title_short | Nasal mucus glutathione transferase activity and impact on olfactory perception and neonatal behavior |
title_sort | nasal mucus glutathione transferase activity and impact on olfactory perception and neonatal behavior |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6395716/ https://www.ncbi.nlm.nih.gov/pubmed/30816217 http://dx.doi.org/10.1038/s41598-019-39495-6 |
work_keys_str_mv | AT roberthazottealine nasalmucusglutathionetransferaseactivityandimpactonolfactoryperceptionandneonatalbehavior AT faurephilippe nasalmucusglutathionetransferaseactivityandimpactonolfactoryperceptionandneonatalbehavior AT neiersfabrice nasalmucusglutathionetransferaseactivityandimpactonolfactoryperceptionandneonatalbehavior AT potincatherine nasalmucusglutathionetransferaseactivityandimpactonolfactoryperceptionandneonatalbehavior AT arturyves nasalmucusglutathionetransferaseactivityandimpactonolfactoryperceptionandneonatalbehavior AT coureaudgerard nasalmucusglutathionetransferaseactivityandimpactonolfactoryperceptionandneonatalbehavior AT heydeljeanmarie nasalmucusglutathionetransferaseactivityandimpactonolfactoryperceptionandneonatalbehavior |