Cargando…
Local atomic structure of thin and ultrathin films via rapid high-energy X-ray total scattering at grazing incidence
Atomic pair distribution function (PDF) analysis is the most powerful technique to study the structure of condensed matter on the length scale from short- to long-range order. Today, the PDF approach is an integral part of research on amorphous, nanocrystalline and disordered materials from bulk to...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
International Union of Crystallography
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6400183/ https://www.ncbi.nlm.nih.gov/pubmed/30867926 http://dx.doi.org/10.1107/S2052252519000514 |
_version_ | 1783399910684491776 |
---|---|
author | Dippel, Ann-Christin Roelsgaard, Martin Boettger, Ulrich Schneller, Theodor Gutowski, Olof Ruett, Uta |
author_facet | Dippel, Ann-Christin Roelsgaard, Martin Boettger, Ulrich Schneller, Theodor Gutowski, Olof Ruett, Uta |
author_sort | Dippel, Ann-Christin |
collection | PubMed |
description | Atomic pair distribution function (PDF) analysis is the most powerful technique to study the structure of condensed matter on the length scale from short- to long-range order. Today, the PDF approach is an integral part of research on amorphous, nanocrystalline and disordered materials from bulk to nanoparticle size. Thin films, however, demand specific experimental strategies for enhanced surface sensitivity and sophisticated data treatment to obtain high-quality PDF data. The approach described here is based on the surface high-energy X-ray diffraction technique applying photon energies above 60 keV at grazing incidence. In this way, reliable PDFs were extracted from films of thicknesses down to a few nanometres. Compared with recently published reports on thin-film PDF analysis from both transmission and grazing-incidence geometries, this work brought the minimum detectable film thickness down by about a factor of ten. Depending on the scattering power of the sample, the data acquisition on such ultrathin films can be completed within fractions of a second. Hence, the rapid-acquisition grazing-incidence PDF method is a major advancement in thin-film technology that opens unprecedented possibilities for in situ and operando PDF studies in complex sample environments. By uncovering how the structure of a layered material on a substrate evolves and transforms in terms of local and average ordering, this technique offers new opportunities for understanding processes such as nucleation, growth, morphology evolution, crystallization and the related kinetics on the atomic level and in real time. |
format | Online Article Text |
id | pubmed-6400183 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | International Union of Crystallography |
record_format | MEDLINE/PubMed |
spelling | pubmed-64001832019-03-13 Local atomic structure of thin and ultrathin films via rapid high-energy X-ray total scattering at grazing incidence Dippel, Ann-Christin Roelsgaard, Martin Boettger, Ulrich Schneller, Theodor Gutowski, Olof Ruett, Uta IUCrJ Research Papers Atomic pair distribution function (PDF) analysis is the most powerful technique to study the structure of condensed matter on the length scale from short- to long-range order. Today, the PDF approach is an integral part of research on amorphous, nanocrystalline and disordered materials from bulk to nanoparticle size. Thin films, however, demand specific experimental strategies for enhanced surface sensitivity and sophisticated data treatment to obtain high-quality PDF data. The approach described here is based on the surface high-energy X-ray diffraction technique applying photon energies above 60 keV at grazing incidence. In this way, reliable PDFs were extracted from films of thicknesses down to a few nanometres. Compared with recently published reports on thin-film PDF analysis from both transmission and grazing-incidence geometries, this work brought the minimum detectable film thickness down by about a factor of ten. Depending on the scattering power of the sample, the data acquisition on such ultrathin films can be completed within fractions of a second. Hence, the rapid-acquisition grazing-incidence PDF method is a major advancement in thin-film technology that opens unprecedented possibilities for in situ and operando PDF studies in complex sample environments. By uncovering how the structure of a layered material on a substrate evolves and transforms in terms of local and average ordering, this technique offers new opportunities for understanding processes such as nucleation, growth, morphology evolution, crystallization and the related kinetics on the atomic level and in real time. International Union of Crystallography 2019-02-21 /pmc/articles/PMC6400183/ /pubmed/30867926 http://dx.doi.org/10.1107/S2052252519000514 Text en © Ann-Christin Dippel et al. 2019 http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution (CC-BY) Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original authors and source are cited.http://creativecommons.org/licenses/by/4.0/ |
spellingShingle | Research Papers Dippel, Ann-Christin Roelsgaard, Martin Boettger, Ulrich Schneller, Theodor Gutowski, Olof Ruett, Uta Local atomic structure of thin and ultrathin films via rapid high-energy X-ray total scattering at grazing incidence |
title | Local atomic structure of thin and ultrathin films via rapid high-energy X-ray total scattering at grazing incidence |
title_full | Local atomic structure of thin and ultrathin films via rapid high-energy X-ray total scattering at grazing incidence |
title_fullStr | Local atomic structure of thin and ultrathin films via rapid high-energy X-ray total scattering at grazing incidence |
title_full_unstemmed | Local atomic structure of thin and ultrathin films via rapid high-energy X-ray total scattering at grazing incidence |
title_short | Local atomic structure of thin and ultrathin films via rapid high-energy X-ray total scattering at grazing incidence |
title_sort | local atomic structure of thin and ultrathin films via rapid high-energy x-ray total scattering at grazing incidence |
topic | Research Papers |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6400183/ https://www.ncbi.nlm.nih.gov/pubmed/30867926 http://dx.doi.org/10.1107/S2052252519000514 |
work_keys_str_mv | AT dippelannchristin localatomicstructureofthinandultrathinfilmsviarapidhighenergyxraytotalscatteringatgrazingincidence AT roelsgaardmartin localatomicstructureofthinandultrathinfilmsviarapidhighenergyxraytotalscatteringatgrazingincidence AT boettgerulrich localatomicstructureofthinandultrathinfilmsviarapidhighenergyxraytotalscatteringatgrazingincidence AT schnellertheodor localatomicstructureofthinandultrathinfilmsviarapidhighenergyxraytotalscatteringatgrazingincidence AT gutowskiolof localatomicstructureofthinandultrathinfilmsviarapidhighenergyxraytotalscatteringatgrazingincidence AT ruettuta localatomicstructureofthinandultrathinfilmsviarapidhighenergyxraytotalscatteringatgrazingincidence |