Cargando…

Treatment and Prevention of Recurrent Clostridium difficile Infection with Functionalized Bovine Antibody-Enriched Whey in a Hamster Primary Infection Model

Toxin-induced Clostridium difficile infection (CDI) is a major disease characterized by severe diarrhea and high morbidity rates. The aim with this study was to develop an alternative drug for the treatment of CDI. Cows were repeatedly immunized to establish specific immunoglobulin G and A titers ag...

Descripción completa

Detalles Bibliográficos
Autores principales: Heidebrecht, Hans-Jürgen, Weiss, William J, Pulse, Mark, Lange, Anton, Gisch, Karina, Kliem, Heike, Mann, Sacha, Pfaffl, Michael W., Kulozik, Ulrich, von Eichel-Streiber, Christoph
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6409564/
https://www.ncbi.nlm.nih.gov/pubmed/30736358
http://dx.doi.org/10.3390/toxins11020098
_version_ 1783402003080151040
author Heidebrecht, Hans-Jürgen
Weiss, William J
Pulse, Mark
Lange, Anton
Gisch, Karina
Kliem, Heike
Mann, Sacha
Pfaffl, Michael W.
Kulozik, Ulrich
von Eichel-Streiber, Christoph
author_facet Heidebrecht, Hans-Jürgen
Weiss, William J
Pulse, Mark
Lange, Anton
Gisch, Karina
Kliem, Heike
Mann, Sacha
Pfaffl, Michael W.
Kulozik, Ulrich
von Eichel-Streiber, Christoph
author_sort Heidebrecht, Hans-Jürgen
collection PubMed
description Toxin-induced Clostridium difficile infection (CDI) is a major disease characterized by severe diarrhea and high morbidity rates. The aim with this study was to develop an alternative drug for the treatment of CDI. Cows were repeatedly immunized to establish specific immunoglobulin G and A titers against toxins A (TcdA) and B (TcdB) and against C. difficile cells in mature milk or colostrum. The effect of three different concentrations of anti-C. difficile whey protein isolates (anti-CD-WPI) and the standard of care antibiotic vancomycin were investigated in an animal model of CD infected hamsters (6 groups, with 10 hamsters each). WPI obtained from the milk of exactly the same cows pre-immunization and a vehicle group served as negative controls. The survival of hamsters receiving anti-CD-WPI was 50, 80 and 100% compared to 10 and 0% for the control groups, respectively. Vancomycin suppressed the growth of C. difficile and thus protected the hamsters at the time of administration, but 90% of these hamsters nevertheless died shortly after discontinuation of treatment. In contrast, the surviving hamsters of the anti-CD-WPI groups survived the entire study period, although they were treated for only 75 h. The specific antibodies not only inactivated the toxins for initial suppression of CDI, but also provoked the inhibition of C. difficile growth after discontinuation, thus preventing recurrence. Oral administration of anti-CD-WPI is a functional therapy of CDI in infected hamsters for both primary treatment and prevention of recurrence. Thus, anti-CD-WPI could address the urgent unmet medical need for treating and preventing recurrent CDI in humans.
format Online
Article
Text
id pubmed-6409564
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-64095642019-04-01 Treatment and Prevention of Recurrent Clostridium difficile Infection with Functionalized Bovine Antibody-Enriched Whey in a Hamster Primary Infection Model Heidebrecht, Hans-Jürgen Weiss, William J Pulse, Mark Lange, Anton Gisch, Karina Kliem, Heike Mann, Sacha Pfaffl, Michael W. Kulozik, Ulrich von Eichel-Streiber, Christoph Toxins (Basel) Article Toxin-induced Clostridium difficile infection (CDI) is a major disease characterized by severe diarrhea and high morbidity rates. The aim with this study was to develop an alternative drug for the treatment of CDI. Cows were repeatedly immunized to establish specific immunoglobulin G and A titers against toxins A (TcdA) and B (TcdB) and against C. difficile cells in mature milk or colostrum. The effect of three different concentrations of anti-C. difficile whey protein isolates (anti-CD-WPI) and the standard of care antibiotic vancomycin were investigated in an animal model of CD infected hamsters (6 groups, with 10 hamsters each). WPI obtained from the milk of exactly the same cows pre-immunization and a vehicle group served as negative controls. The survival of hamsters receiving anti-CD-WPI was 50, 80 and 100% compared to 10 and 0% for the control groups, respectively. Vancomycin suppressed the growth of C. difficile and thus protected the hamsters at the time of administration, but 90% of these hamsters nevertheless died shortly after discontinuation of treatment. In contrast, the surviving hamsters of the anti-CD-WPI groups survived the entire study period, although they were treated for only 75 h. The specific antibodies not only inactivated the toxins for initial suppression of CDI, but also provoked the inhibition of C. difficile growth after discontinuation, thus preventing recurrence. Oral administration of anti-CD-WPI is a functional therapy of CDI in infected hamsters for both primary treatment and prevention of recurrence. Thus, anti-CD-WPI could address the urgent unmet medical need for treating and preventing recurrent CDI in humans. MDPI 2019-02-06 /pmc/articles/PMC6409564/ /pubmed/30736358 http://dx.doi.org/10.3390/toxins11020098 Text en © 2019 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
spellingShingle Article
Heidebrecht, Hans-Jürgen
Weiss, William J
Pulse, Mark
Lange, Anton
Gisch, Karina
Kliem, Heike
Mann, Sacha
Pfaffl, Michael W.
Kulozik, Ulrich
von Eichel-Streiber, Christoph
Treatment and Prevention of Recurrent Clostridium difficile Infection with Functionalized Bovine Antibody-Enriched Whey in a Hamster Primary Infection Model
title Treatment and Prevention of Recurrent Clostridium difficile Infection with Functionalized Bovine Antibody-Enriched Whey in a Hamster Primary Infection Model
title_full Treatment and Prevention of Recurrent Clostridium difficile Infection with Functionalized Bovine Antibody-Enriched Whey in a Hamster Primary Infection Model
title_fullStr Treatment and Prevention of Recurrent Clostridium difficile Infection with Functionalized Bovine Antibody-Enriched Whey in a Hamster Primary Infection Model
title_full_unstemmed Treatment and Prevention of Recurrent Clostridium difficile Infection with Functionalized Bovine Antibody-Enriched Whey in a Hamster Primary Infection Model
title_short Treatment and Prevention of Recurrent Clostridium difficile Infection with Functionalized Bovine Antibody-Enriched Whey in a Hamster Primary Infection Model
title_sort treatment and prevention of recurrent clostridium difficile infection with functionalized bovine antibody-enriched whey in a hamster primary infection model
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6409564/
https://www.ncbi.nlm.nih.gov/pubmed/30736358
http://dx.doi.org/10.3390/toxins11020098
work_keys_str_mv AT heidebrechthansjurgen treatmentandpreventionofrecurrentclostridiumdifficileinfectionwithfunctionalizedbovineantibodyenrichedwheyinahamsterprimaryinfectionmodel
AT weisswilliamj treatmentandpreventionofrecurrentclostridiumdifficileinfectionwithfunctionalizedbovineantibodyenrichedwheyinahamsterprimaryinfectionmodel
AT pulsemark treatmentandpreventionofrecurrentclostridiumdifficileinfectionwithfunctionalizedbovineantibodyenrichedwheyinahamsterprimaryinfectionmodel
AT langeanton treatmentandpreventionofrecurrentclostridiumdifficileinfectionwithfunctionalizedbovineantibodyenrichedwheyinahamsterprimaryinfectionmodel
AT gischkarina treatmentandpreventionofrecurrentclostridiumdifficileinfectionwithfunctionalizedbovineantibodyenrichedwheyinahamsterprimaryinfectionmodel
AT kliemheike treatmentandpreventionofrecurrentclostridiumdifficileinfectionwithfunctionalizedbovineantibodyenrichedwheyinahamsterprimaryinfectionmodel
AT mannsacha treatmentandpreventionofrecurrentclostridiumdifficileinfectionwithfunctionalizedbovineantibodyenrichedwheyinahamsterprimaryinfectionmodel
AT pfafflmichaelw treatmentandpreventionofrecurrentclostridiumdifficileinfectionwithfunctionalizedbovineantibodyenrichedwheyinahamsterprimaryinfectionmodel
AT kulozikulrich treatmentandpreventionofrecurrentclostridiumdifficileinfectionwithfunctionalizedbovineantibodyenrichedwheyinahamsterprimaryinfectionmodel
AT voneichelstreiberchristoph treatmentandpreventionofrecurrentclostridiumdifficileinfectionwithfunctionalizedbovineantibodyenrichedwheyinahamsterprimaryinfectionmodel