Cargando…

The grapevine (Vitis vinifera) LysM receptor kinases VvLYK1‐1 and VvLYK1‐2 mediate chitooligosaccharide‐triggered immunity

Chitin, a major component of fungal cell walls, is a well‐known pathogen‐associated molecular pattern (PAMP) that triggers defense responses in several mammal and plant species. Here, we show that two chitooligosaccharides, chitin and chitosan, act as PAMPs in grapevine (Vitis vinifera) as they elic...

Descripción completa

Detalles Bibliográficos
Autores principales: Brulé, Daphnée, Villano, Clizia, Davies, Laura J., Trdá, Lucie, Claverie, Justine, Héloir, Marie‐Claire, Chiltz, Annick, Adrian, Marielle, Darblade, Benoît, Tornero, Pablo, Stransfeld, Lena, Boutrot, Freddy, Zipfel, Cyril, Dry, Ian B., Poinssot, Benoit
Formato: Online Artículo Texto
Lenguaje:English
Publicado: John Wiley and Sons Inc. 2018
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6419575/
https://www.ncbi.nlm.nih.gov/pubmed/30256508
http://dx.doi.org/10.1111/pbi.13017
_version_ 1783403973680562176
author Brulé, Daphnée
Villano, Clizia
Davies, Laura J.
Trdá, Lucie
Claverie, Justine
Héloir, Marie‐Claire
Chiltz, Annick
Adrian, Marielle
Darblade, Benoît
Tornero, Pablo
Stransfeld, Lena
Boutrot, Freddy
Zipfel, Cyril
Dry, Ian B.
Poinssot, Benoit
author_facet Brulé, Daphnée
Villano, Clizia
Davies, Laura J.
Trdá, Lucie
Claverie, Justine
Héloir, Marie‐Claire
Chiltz, Annick
Adrian, Marielle
Darblade, Benoît
Tornero, Pablo
Stransfeld, Lena
Boutrot, Freddy
Zipfel, Cyril
Dry, Ian B.
Poinssot, Benoit
author_sort Brulé, Daphnée
collection PubMed
description Chitin, a major component of fungal cell walls, is a well‐known pathogen‐associated molecular pattern (PAMP) that triggers defense responses in several mammal and plant species. Here, we show that two chitooligosaccharides, chitin and chitosan, act as PAMPs in grapevine (Vitis vinifera) as they elicit immune signalling events, defense gene expression and resistance against fungal diseases. To identify their cognate receptors, the grapevine family of LysM receptor kinases (LysM‐RKs) was annotated and their gene expression profiles were characterized. Phylogenetic analysis clearly distinguished three V. vinifera LysM‐RKs (VvLYKs) located in the same clade as the Arabidopsis CHITIN ELICITOR RECEPTOR KINASE1 (AtCERK1), which mediates chitin‐induced immune responses. The Arabidopsis mutant Atcerk1, impaired in chitin perception, was transformed with these three putative orthologous genes encoding VvLYK1‐1, ‐2, or ‐3 to determine if they would complement the loss of AtCERK1 function. Our results provide evidence that VvLYK1‐1 and VvLYK1‐2, but not VvLYK1‐3, functionally complement the Atcerk1 mutant by restoring chitooligosaccharide‐induced MAPK activation and immune gene expression. Moreover, expression of VvLYK1‐1 in Atcerk1 restored penetration resistance to the non‐adapted grapevine powdery mildew (Erysiphe necator). On the whole, our results indicate that the grapevine VvLYK1‐1 and VvLYK1‐2 participate in chitin‐ and chitosan‐triggered immunity and that VvLYK1‐1 plays an important role in basal resistance against E. necator.
format Online
Article
Text
id pubmed-6419575
institution National Center for Biotechnology Information
language English
publishDate 2018
publisher John Wiley and Sons Inc.
record_format MEDLINE/PubMed
spelling pubmed-64195752019-03-18 The grapevine (Vitis vinifera) LysM receptor kinases VvLYK1‐1 and VvLYK1‐2 mediate chitooligosaccharide‐triggered immunity Brulé, Daphnée Villano, Clizia Davies, Laura J. Trdá, Lucie Claverie, Justine Héloir, Marie‐Claire Chiltz, Annick Adrian, Marielle Darblade, Benoît Tornero, Pablo Stransfeld, Lena Boutrot, Freddy Zipfel, Cyril Dry, Ian B. Poinssot, Benoit Plant Biotechnol J Research Articles Chitin, a major component of fungal cell walls, is a well‐known pathogen‐associated molecular pattern (PAMP) that triggers defense responses in several mammal and plant species. Here, we show that two chitooligosaccharides, chitin and chitosan, act as PAMPs in grapevine (Vitis vinifera) as they elicit immune signalling events, defense gene expression and resistance against fungal diseases. To identify their cognate receptors, the grapevine family of LysM receptor kinases (LysM‐RKs) was annotated and their gene expression profiles were characterized. Phylogenetic analysis clearly distinguished three V. vinifera LysM‐RKs (VvLYKs) located in the same clade as the Arabidopsis CHITIN ELICITOR RECEPTOR KINASE1 (AtCERK1), which mediates chitin‐induced immune responses. The Arabidopsis mutant Atcerk1, impaired in chitin perception, was transformed with these three putative orthologous genes encoding VvLYK1‐1, ‐2, or ‐3 to determine if they would complement the loss of AtCERK1 function. Our results provide evidence that VvLYK1‐1 and VvLYK1‐2, but not VvLYK1‐3, functionally complement the Atcerk1 mutant by restoring chitooligosaccharide‐induced MAPK activation and immune gene expression. Moreover, expression of VvLYK1‐1 in Atcerk1 restored penetration resistance to the non‐adapted grapevine powdery mildew (Erysiphe necator). On the whole, our results indicate that the grapevine VvLYK1‐1 and VvLYK1‐2 participate in chitin‐ and chitosan‐triggered immunity and that VvLYK1‐1 plays an important role in basal resistance against E. necator. John Wiley and Sons Inc. 2018-10-22 2019-04 /pmc/articles/PMC6419575/ /pubmed/30256508 http://dx.doi.org/10.1111/pbi.13017 Text en © 2018 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd. This is an open access article under the terms of the http://creativecommons.org/licenses/by/4.0/ License, which permits use, distribution and reproduction in any medium, provided the original work is properly cited.
spellingShingle Research Articles
Brulé, Daphnée
Villano, Clizia
Davies, Laura J.
Trdá, Lucie
Claverie, Justine
Héloir, Marie‐Claire
Chiltz, Annick
Adrian, Marielle
Darblade, Benoît
Tornero, Pablo
Stransfeld, Lena
Boutrot, Freddy
Zipfel, Cyril
Dry, Ian B.
Poinssot, Benoit
The grapevine (Vitis vinifera) LysM receptor kinases VvLYK1‐1 and VvLYK1‐2 mediate chitooligosaccharide‐triggered immunity
title The grapevine (Vitis vinifera) LysM receptor kinases VvLYK1‐1 and VvLYK1‐2 mediate chitooligosaccharide‐triggered immunity
title_full The grapevine (Vitis vinifera) LysM receptor kinases VvLYK1‐1 and VvLYK1‐2 mediate chitooligosaccharide‐triggered immunity
title_fullStr The grapevine (Vitis vinifera) LysM receptor kinases VvLYK1‐1 and VvLYK1‐2 mediate chitooligosaccharide‐triggered immunity
title_full_unstemmed The grapevine (Vitis vinifera) LysM receptor kinases VvLYK1‐1 and VvLYK1‐2 mediate chitooligosaccharide‐triggered immunity
title_short The grapevine (Vitis vinifera) LysM receptor kinases VvLYK1‐1 and VvLYK1‐2 mediate chitooligosaccharide‐triggered immunity
title_sort grapevine (vitis vinifera) lysm receptor kinases vvlyk1‐1 and vvlyk1‐2 mediate chitooligosaccharide‐triggered immunity
topic Research Articles
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6419575/
https://www.ncbi.nlm.nih.gov/pubmed/30256508
http://dx.doi.org/10.1111/pbi.13017
work_keys_str_mv AT bruledaphnee thegrapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity
AT villanoclizia thegrapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity
AT davieslauraj thegrapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity
AT trdalucie thegrapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity
AT claveriejustine thegrapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity
AT heloirmarieclaire thegrapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity
AT chiltzannick thegrapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity
AT adrianmarielle thegrapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity
AT darbladebenoit thegrapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity
AT torneropablo thegrapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity
AT stransfeldlena thegrapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity
AT boutrotfreddy thegrapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity
AT zipfelcyril thegrapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity
AT dryianb thegrapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity
AT poinssotbenoit thegrapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity
AT bruledaphnee grapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity
AT villanoclizia grapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity
AT davieslauraj grapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity
AT trdalucie grapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity
AT claveriejustine grapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity
AT heloirmarieclaire grapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity
AT chiltzannick grapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity
AT adrianmarielle grapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity
AT darbladebenoit grapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity
AT torneropablo grapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity
AT stransfeldlena grapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity
AT boutrotfreddy grapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity
AT zipfelcyril grapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity
AT dryianb grapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity
AT poinssotbenoit grapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity