Cargando…
The grapevine (Vitis vinifera) LysM receptor kinases VvLYK1‐1 and VvLYK1‐2 mediate chitooligosaccharide‐triggered immunity
Chitin, a major component of fungal cell walls, is a well‐known pathogen‐associated molecular pattern (PAMP) that triggers defense responses in several mammal and plant species. Here, we show that two chitooligosaccharides, chitin and chitosan, act as PAMPs in grapevine (Vitis vinifera) as they elic...
Autores principales: | , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
John Wiley and Sons Inc.
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6419575/ https://www.ncbi.nlm.nih.gov/pubmed/30256508 http://dx.doi.org/10.1111/pbi.13017 |
_version_ | 1783403973680562176 |
---|---|
author | Brulé, Daphnée Villano, Clizia Davies, Laura J. Trdá, Lucie Claverie, Justine Héloir, Marie‐Claire Chiltz, Annick Adrian, Marielle Darblade, Benoît Tornero, Pablo Stransfeld, Lena Boutrot, Freddy Zipfel, Cyril Dry, Ian B. Poinssot, Benoit |
author_facet | Brulé, Daphnée Villano, Clizia Davies, Laura J. Trdá, Lucie Claverie, Justine Héloir, Marie‐Claire Chiltz, Annick Adrian, Marielle Darblade, Benoît Tornero, Pablo Stransfeld, Lena Boutrot, Freddy Zipfel, Cyril Dry, Ian B. Poinssot, Benoit |
author_sort | Brulé, Daphnée |
collection | PubMed |
description | Chitin, a major component of fungal cell walls, is a well‐known pathogen‐associated molecular pattern (PAMP) that triggers defense responses in several mammal and plant species. Here, we show that two chitooligosaccharides, chitin and chitosan, act as PAMPs in grapevine (Vitis vinifera) as they elicit immune signalling events, defense gene expression and resistance against fungal diseases. To identify their cognate receptors, the grapevine family of LysM receptor kinases (LysM‐RKs) was annotated and their gene expression profiles were characterized. Phylogenetic analysis clearly distinguished three V. vinifera LysM‐RKs (VvLYKs) located in the same clade as the Arabidopsis CHITIN ELICITOR RECEPTOR KINASE1 (AtCERK1), which mediates chitin‐induced immune responses. The Arabidopsis mutant Atcerk1, impaired in chitin perception, was transformed with these three putative orthologous genes encoding VvLYK1‐1, ‐2, or ‐3 to determine if they would complement the loss of AtCERK1 function. Our results provide evidence that VvLYK1‐1 and VvLYK1‐2, but not VvLYK1‐3, functionally complement the Atcerk1 mutant by restoring chitooligosaccharide‐induced MAPK activation and immune gene expression. Moreover, expression of VvLYK1‐1 in Atcerk1 restored penetration resistance to the non‐adapted grapevine powdery mildew (Erysiphe necator). On the whole, our results indicate that the grapevine VvLYK1‐1 and VvLYK1‐2 participate in chitin‐ and chitosan‐triggered immunity and that VvLYK1‐1 plays an important role in basal resistance against E. necator. |
format | Online Article Text |
id | pubmed-6419575 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | John Wiley and Sons Inc. |
record_format | MEDLINE/PubMed |
spelling | pubmed-64195752019-03-18 The grapevine (Vitis vinifera) LysM receptor kinases VvLYK1‐1 and VvLYK1‐2 mediate chitooligosaccharide‐triggered immunity Brulé, Daphnée Villano, Clizia Davies, Laura J. Trdá, Lucie Claverie, Justine Héloir, Marie‐Claire Chiltz, Annick Adrian, Marielle Darblade, Benoît Tornero, Pablo Stransfeld, Lena Boutrot, Freddy Zipfel, Cyril Dry, Ian B. Poinssot, Benoit Plant Biotechnol J Research Articles Chitin, a major component of fungal cell walls, is a well‐known pathogen‐associated molecular pattern (PAMP) that triggers defense responses in several mammal and plant species. Here, we show that two chitooligosaccharides, chitin and chitosan, act as PAMPs in grapevine (Vitis vinifera) as they elicit immune signalling events, defense gene expression and resistance against fungal diseases. To identify their cognate receptors, the grapevine family of LysM receptor kinases (LysM‐RKs) was annotated and their gene expression profiles were characterized. Phylogenetic analysis clearly distinguished three V. vinifera LysM‐RKs (VvLYKs) located in the same clade as the Arabidopsis CHITIN ELICITOR RECEPTOR KINASE1 (AtCERK1), which mediates chitin‐induced immune responses. The Arabidopsis mutant Atcerk1, impaired in chitin perception, was transformed with these three putative orthologous genes encoding VvLYK1‐1, ‐2, or ‐3 to determine if they would complement the loss of AtCERK1 function. Our results provide evidence that VvLYK1‐1 and VvLYK1‐2, but not VvLYK1‐3, functionally complement the Atcerk1 mutant by restoring chitooligosaccharide‐induced MAPK activation and immune gene expression. Moreover, expression of VvLYK1‐1 in Atcerk1 restored penetration resistance to the non‐adapted grapevine powdery mildew (Erysiphe necator). On the whole, our results indicate that the grapevine VvLYK1‐1 and VvLYK1‐2 participate in chitin‐ and chitosan‐triggered immunity and that VvLYK1‐1 plays an important role in basal resistance against E. necator. John Wiley and Sons Inc. 2018-10-22 2019-04 /pmc/articles/PMC6419575/ /pubmed/30256508 http://dx.doi.org/10.1111/pbi.13017 Text en © 2018 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd. This is an open access article under the terms of the http://creativecommons.org/licenses/by/4.0/ License, which permits use, distribution and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Articles Brulé, Daphnée Villano, Clizia Davies, Laura J. Trdá, Lucie Claverie, Justine Héloir, Marie‐Claire Chiltz, Annick Adrian, Marielle Darblade, Benoît Tornero, Pablo Stransfeld, Lena Boutrot, Freddy Zipfel, Cyril Dry, Ian B. Poinssot, Benoit The grapevine (Vitis vinifera) LysM receptor kinases VvLYK1‐1 and VvLYK1‐2 mediate chitooligosaccharide‐triggered immunity |
title | The grapevine (Vitis vinifera) LysM receptor kinases VvLYK1‐1 and VvLYK1‐2 mediate chitooligosaccharide‐triggered immunity |
title_full | The grapevine (Vitis vinifera) LysM receptor kinases VvLYK1‐1 and VvLYK1‐2 mediate chitooligosaccharide‐triggered immunity |
title_fullStr | The grapevine (Vitis vinifera) LysM receptor kinases VvLYK1‐1 and VvLYK1‐2 mediate chitooligosaccharide‐triggered immunity |
title_full_unstemmed | The grapevine (Vitis vinifera) LysM receptor kinases VvLYK1‐1 and VvLYK1‐2 mediate chitooligosaccharide‐triggered immunity |
title_short | The grapevine (Vitis vinifera) LysM receptor kinases VvLYK1‐1 and VvLYK1‐2 mediate chitooligosaccharide‐triggered immunity |
title_sort | grapevine (vitis vinifera) lysm receptor kinases vvlyk1‐1 and vvlyk1‐2 mediate chitooligosaccharide‐triggered immunity |
topic | Research Articles |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6419575/ https://www.ncbi.nlm.nih.gov/pubmed/30256508 http://dx.doi.org/10.1111/pbi.13017 |
work_keys_str_mv | AT bruledaphnee thegrapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity AT villanoclizia thegrapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity AT davieslauraj thegrapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity AT trdalucie thegrapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity AT claveriejustine thegrapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity AT heloirmarieclaire thegrapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity AT chiltzannick thegrapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity AT adrianmarielle thegrapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity AT darbladebenoit thegrapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity AT torneropablo thegrapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity AT stransfeldlena thegrapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity AT boutrotfreddy thegrapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity AT zipfelcyril thegrapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity AT dryianb thegrapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity AT poinssotbenoit thegrapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity AT bruledaphnee grapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity AT villanoclizia grapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity AT davieslauraj grapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity AT trdalucie grapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity AT claveriejustine grapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity AT heloirmarieclaire grapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity AT chiltzannick grapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity AT adrianmarielle grapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity AT darbladebenoit grapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity AT torneropablo grapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity AT stransfeldlena grapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity AT boutrotfreddy grapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity AT zipfelcyril grapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity AT dryianb grapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity AT poinssotbenoit grapevinevitisviniferalysmreceptorkinasesvvlyk11andvvlyk12mediatechitooligosaccharidetriggeredimmunity |