Cargando…

A newborn with seizures born to a mother diagnosed with primary carnitine deficiency

BACKGROUND: Maternofetal carnitine transport through the placenta is the main route of fetal carnitine uptake. Decreased free carnitine levels discovered by newborn screening has identified many asymptomatic adult women with systemic primary carnitine deficiency (PCD). Here, we presented amplitude i...

Descripción completa

Detalles Bibliográficos
Autores principales: Chen, Si, Hu, Yingying, Huang, Yumei, Nan, Yan, Zhou, Xiaojian, Chen, Shangqin, Lin, Jin, Lin, Zhenlang
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6421665/
https://www.ncbi.nlm.nih.gov/pubmed/30885166
http://dx.doi.org/10.1186/s12887-019-1452-4
_version_ 1783404269338099712
author Chen, Si
Hu, Yingying
Huang, Yumei
Nan, Yan
Zhou, Xiaojian
Chen, Shangqin
Lin, Jin
Lin, Zhenlang
author_facet Chen, Si
Hu, Yingying
Huang, Yumei
Nan, Yan
Zhou, Xiaojian
Chen, Shangqin
Lin, Jin
Lin, Zhenlang
author_sort Chen, Si
collection PubMed
description BACKGROUND: Maternofetal carnitine transport through the placenta is the main route of fetal carnitine uptake. Decreased free carnitine levels discovered by newborn screening has identified many asymptomatic adult women with systemic primary carnitine deficiency (PCD). Here, we presented amplitude integrated electroencephalogram (aEEG) and magnetic resonance imaging (MRI) findings from a neonate with epilepsy whose mother was carnitine deficient. CASE PRESENTATION: A one-day-old female newborn was admitted after experiencing seizures for half a day; status epilepticus was found on the continuous normal voltage background pattern with immature sleep-wake cycling during aEEG monitoring. On T1-weighted, T2-weighted, FLAIR, and DWI head MRI, there were various degrees of hyperintense signals and diffusion restrictions in the deep white matter of the right hemisphere. Tandem mass spectrometry discovered carnitine deficiency on the second day, which elevated to normal by the 9th day before L-carnitine supplementation was started. The patient was treated with phenobarbital after admission. No further seizures were noted by day 5. It was confirmed that the patient’s mother had a low level of serum-free carnitine. Gene analyses revealed that the newborn had heterozygote mutations on c.1400C > G of the SLC22A5 gene, and her mother had homozygous mutations on c.1400C > G. The patient had a good outcome at the 8-month follow up. CONCLUSIONS: Maternal carnitine deficiency that occurs during the perinatal period may manifest as secondary epilepsy with cerebral injury in neonates. The short-term neurodevelopmental outcomes were good. Early diagnosis of asymptomatic PCD in female patients can provide guidance for future pregnancies.
format Online
Article
Text
id pubmed-6421665
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-64216652019-03-28 A newborn with seizures born to a mother diagnosed with primary carnitine deficiency Chen, Si Hu, Yingying Huang, Yumei Nan, Yan Zhou, Xiaojian Chen, Shangqin Lin, Jin Lin, Zhenlang BMC Pediatr Case Report BACKGROUND: Maternofetal carnitine transport through the placenta is the main route of fetal carnitine uptake. Decreased free carnitine levels discovered by newborn screening has identified many asymptomatic adult women with systemic primary carnitine deficiency (PCD). Here, we presented amplitude integrated electroencephalogram (aEEG) and magnetic resonance imaging (MRI) findings from a neonate with epilepsy whose mother was carnitine deficient. CASE PRESENTATION: A one-day-old female newborn was admitted after experiencing seizures for half a day; status epilepticus was found on the continuous normal voltage background pattern with immature sleep-wake cycling during aEEG monitoring. On T1-weighted, T2-weighted, FLAIR, and DWI head MRI, there were various degrees of hyperintense signals and diffusion restrictions in the deep white matter of the right hemisphere. Tandem mass spectrometry discovered carnitine deficiency on the second day, which elevated to normal by the 9th day before L-carnitine supplementation was started. The patient was treated with phenobarbital after admission. No further seizures were noted by day 5. It was confirmed that the patient’s mother had a low level of serum-free carnitine. Gene analyses revealed that the newborn had heterozygote mutations on c.1400C > G of the SLC22A5 gene, and her mother had homozygous mutations on c.1400C > G. The patient had a good outcome at the 8-month follow up. CONCLUSIONS: Maternal carnitine deficiency that occurs during the perinatal period may manifest as secondary epilepsy with cerebral injury in neonates. The short-term neurodevelopmental outcomes were good. Early diagnosis of asymptomatic PCD in female patients can provide guidance for future pregnancies. BioMed Central 2019-03-18 /pmc/articles/PMC6421665/ /pubmed/30885166 http://dx.doi.org/10.1186/s12887-019-1452-4 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Case Report
Chen, Si
Hu, Yingying
Huang, Yumei
Nan, Yan
Zhou, Xiaojian
Chen, Shangqin
Lin, Jin
Lin, Zhenlang
A newborn with seizures born to a mother diagnosed with primary carnitine deficiency
title A newborn with seizures born to a mother diagnosed with primary carnitine deficiency
title_full A newborn with seizures born to a mother diagnosed with primary carnitine deficiency
title_fullStr A newborn with seizures born to a mother diagnosed with primary carnitine deficiency
title_full_unstemmed A newborn with seizures born to a mother diagnosed with primary carnitine deficiency
title_short A newborn with seizures born to a mother diagnosed with primary carnitine deficiency
title_sort newborn with seizures born to a mother diagnosed with primary carnitine deficiency
topic Case Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6421665/
https://www.ncbi.nlm.nih.gov/pubmed/30885166
http://dx.doi.org/10.1186/s12887-019-1452-4
work_keys_str_mv AT chensi anewbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency
AT huyingying anewbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency
AT huangyumei anewbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency
AT nanyan anewbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency
AT zhouxiaojian anewbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency
AT chenshangqin anewbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency
AT linjin anewbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency
AT linzhenlang anewbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency
AT chensi newbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency
AT huyingying newbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency
AT huangyumei newbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency
AT nanyan newbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency
AT zhouxiaojian newbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency
AT chenshangqin newbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency
AT linjin newbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency
AT linzhenlang newbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency