Cargando…
A newborn with seizures born to a mother diagnosed with primary carnitine deficiency
BACKGROUND: Maternofetal carnitine transport through the placenta is the main route of fetal carnitine uptake. Decreased free carnitine levels discovered by newborn screening has identified many asymptomatic adult women with systemic primary carnitine deficiency (PCD). Here, we presented amplitude i...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6421665/ https://www.ncbi.nlm.nih.gov/pubmed/30885166 http://dx.doi.org/10.1186/s12887-019-1452-4 |
_version_ | 1783404269338099712 |
---|---|
author | Chen, Si Hu, Yingying Huang, Yumei Nan, Yan Zhou, Xiaojian Chen, Shangqin Lin, Jin Lin, Zhenlang |
author_facet | Chen, Si Hu, Yingying Huang, Yumei Nan, Yan Zhou, Xiaojian Chen, Shangqin Lin, Jin Lin, Zhenlang |
author_sort | Chen, Si |
collection | PubMed |
description | BACKGROUND: Maternofetal carnitine transport through the placenta is the main route of fetal carnitine uptake. Decreased free carnitine levels discovered by newborn screening has identified many asymptomatic adult women with systemic primary carnitine deficiency (PCD). Here, we presented amplitude integrated electroencephalogram (aEEG) and magnetic resonance imaging (MRI) findings from a neonate with epilepsy whose mother was carnitine deficient. CASE PRESENTATION: A one-day-old female newborn was admitted after experiencing seizures for half a day; status epilepticus was found on the continuous normal voltage background pattern with immature sleep-wake cycling during aEEG monitoring. On T1-weighted, T2-weighted, FLAIR, and DWI head MRI, there were various degrees of hyperintense signals and diffusion restrictions in the deep white matter of the right hemisphere. Tandem mass spectrometry discovered carnitine deficiency on the second day, which elevated to normal by the 9th day before L-carnitine supplementation was started. The patient was treated with phenobarbital after admission. No further seizures were noted by day 5. It was confirmed that the patient’s mother had a low level of serum-free carnitine. Gene analyses revealed that the newborn had heterozygote mutations on c.1400C > G of the SLC22A5 gene, and her mother had homozygous mutations on c.1400C > G. The patient had a good outcome at the 8-month follow up. CONCLUSIONS: Maternal carnitine deficiency that occurs during the perinatal period may manifest as secondary epilepsy with cerebral injury in neonates. The short-term neurodevelopmental outcomes were good. Early diagnosis of asymptomatic PCD in female patients can provide guidance for future pregnancies. |
format | Online Article Text |
id | pubmed-6421665 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-64216652019-03-28 A newborn with seizures born to a mother diagnosed with primary carnitine deficiency Chen, Si Hu, Yingying Huang, Yumei Nan, Yan Zhou, Xiaojian Chen, Shangqin Lin, Jin Lin, Zhenlang BMC Pediatr Case Report BACKGROUND: Maternofetal carnitine transport through the placenta is the main route of fetal carnitine uptake. Decreased free carnitine levels discovered by newborn screening has identified many asymptomatic adult women with systemic primary carnitine deficiency (PCD). Here, we presented amplitude integrated electroencephalogram (aEEG) and magnetic resonance imaging (MRI) findings from a neonate with epilepsy whose mother was carnitine deficient. CASE PRESENTATION: A one-day-old female newborn was admitted after experiencing seizures for half a day; status epilepticus was found on the continuous normal voltage background pattern with immature sleep-wake cycling during aEEG monitoring. On T1-weighted, T2-weighted, FLAIR, and DWI head MRI, there were various degrees of hyperintense signals and diffusion restrictions in the deep white matter of the right hemisphere. Tandem mass spectrometry discovered carnitine deficiency on the second day, which elevated to normal by the 9th day before L-carnitine supplementation was started. The patient was treated with phenobarbital after admission. No further seizures were noted by day 5. It was confirmed that the patient’s mother had a low level of serum-free carnitine. Gene analyses revealed that the newborn had heterozygote mutations on c.1400C > G of the SLC22A5 gene, and her mother had homozygous mutations on c.1400C > G. The patient had a good outcome at the 8-month follow up. CONCLUSIONS: Maternal carnitine deficiency that occurs during the perinatal period may manifest as secondary epilepsy with cerebral injury in neonates. The short-term neurodevelopmental outcomes were good. Early diagnosis of asymptomatic PCD in female patients can provide guidance for future pregnancies. BioMed Central 2019-03-18 /pmc/articles/PMC6421665/ /pubmed/30885166 http://dx.doi.org/10.1186/s12887-019-1452-4 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Case Report Chen, Si Hu, Yingying Huang, Yumei Nan, Yan Zhou, Xiaojian Chen, Shangqin Lin, Jin Lin, Zhenlang A newborn with seizures born to a mother diagnosed with primary carnitine deficiency |
title | A newborn with seizures born to a mother diagnosed with primary carnitine deficiency |
title_full | A newborn with seizures born to a mother diagnosed with primary carnitine deficiency |
title_fullStr | A newborn with seizures born to a mother diagnosed with primary carnitine deficiency |
title_full_unstemmed | A newborn with seizures born to a mother diagnosed with primary carnitine deficiency |
title_short | A newborn with seizures born to a mother diagnosed with primary carnitine deficiency |
title_sort | newborn with seizures born to a mother diagnosed with primary carnitine deficiency |
topic | Case Report |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6421665/ https://www.ncbi.nlm.nih.gov/pubmed/30885166 http://dx.doi.org/10.1186/s12887-019-1452-4 |
work_keys_str_mv | AT chensi anewbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency AT huyingying anewbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency AT huangyumei anewbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency AT nanyan anewbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency AT zhouxiaojian anewbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency AT chenshangqin anewbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency AT linjin anewbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency AT linzhenlang anewbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency AT chensi newbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency AT huyingying newbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency AT huangyumei newbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency AT nanyan newbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency AT zhouxiaojian newbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency AT chenshangqin newbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency AT linjin newbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency AT linzhenlang newbornwithseizuresborntoamotherdiagnosedwithprimarycarnitinedeficiency |