Cargando…

Familial Vitamin D-dependent rickets Type 2A: A report of two cases with alopecia and oral manifestations

Rickets is a metabolic bone disease that develops as a result of inadequate mineralization of growing bone due to disruption of calcium, phosphorus and/or Vitamin D metabolism. In addition, several rare genetic causes of rickets have also been described, which can be divided into two groups. The fir...

Descripción completa

Detalles Bibliográficos
Autor principal: Thakur, Moni
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Medknow Publications & Media Pvt Ltd 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6421925/
https://www.ncbi.nlm.nih.gov/pubmed/30967742
http://dx.doi.org/10.4103/jomfp.JOMFP_309_18
_version_ 1783404322834350080
author Thakur, Moni
author_facet Thakur, Moni
author_sort Thakur, Moni
collection PubMed
description Rickets is a metabolic bone disease that develops as a result of inadequate mineralization of growing bone due to disruption of calcium, phosphorus and/or Vitamin D metabolism. In addition, several rare genetic causes of rickets have also been described, which can be divided into two groups. The first group consists of genetic disorders of Vitamin D biosynthesis and action, such as Vitamin D-dependent rickets Type 1A, Type 1B, Type 2A (VDDR2A) and Type 2B. The second group involves genetic disorders of excessive renal phosphate loss (hereditary hypophosphatemic rickets). VDDR2A is a rare autosomal recessive disorder caused by mutation in the Vitamin D receptor gene, leading to end-organ resistance to 1,25(OH)(2) Vitamin D(3). It clinically represents growth retardation presenting in the 1(st) year of life and frequently associated with alopecia totalis, which differentiates it from VDDR Type 1. Due to target organ resistance, its response to Vitamin D is poor. We report two cases of familial VDDR2A, with alopecia and oral manifestations.
format Online
Article
Text
id pubmed-6421925
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher Medknow Publications & Media Pvt Ltd
record_format MEDLINE/PubMed
spelling pubmed-64219252019-04-09 Familial Vitamin D-dependent rickets Type 2A: A report of two cases with alopecia and oral manifestations Thakur, Moni J Oral Maxillofac Pathol Case Report Rickets is a metabolic bone disease that develops as a result of inadequate mineralization of growing bone due to disruption of calcium, phosphorus and/or Vitamin D metabolism. In addition, several rare genetic causes of rickets have also been described, which can be divided into two groups. The first group consists of genetic disorders of Vitamin D biosynthesis and action, such as Vitamin D-dependent rickets Type 1A, Type 1B, Type 2A (VDDR2A) and Type 2B. The second group involves genetic disorders of excessive renal phosphate loss (hereditary hypophosphatemic rickets). VDDR2A is a rare autosomal recessive disorder caused by mutation in the Vitamin D receptor gene, leading to end-organ resistance to 1,25(OH)(2) Vitamin D(3). It clinically represents growth retardation presenting in the 1(st) year of life and frequently associated with alopecia totalis, which differentiates it from VDDR Type 1. Due to target organ resistance, its response to Vitamin D is poor. We report two cases of familial VDDR2A, with alopecia and oral manifestations. Medknow Publications & Media Pvt Ltd 2019-02 /pmc/articles/PMC6421925/ /pubmed/30967742 http://dx.doi.org/10.4103/jomfp.JOMFP_309_18 Text en Copyright: © 2019 Journal of Oral and Maxillofacial Pathology http://creativecommons.org/licenses/by-nc-sa/4.0 This is an open access journal, and articles are distributed under the terms of the Creative Commons Attribution-NonCommercial-ShareAlike 4.0 License, which allows others to remix, tweak, and build upon the work non-commercially, as long as appropriate credit is given and the new creations are licensed under the identical terms.
spellingShingle Case Report
Thakur, Moni
Familial Vitamin D-dependent rickets Type 2A: A report of two cases with alopecia and oral manifestations
title Familial Vitamin D-dependent rickets Type 2A: A report of two cases with alopecia and oral manifestations
title_full Familial Vitamin D-dependent rickets Type 2A: A report of two cases with alopecia and oral manifestations
title_fullStr Familial Vitamin D-dependent rickets Type 2A: A report of two cases with alopecia and oral manifestations
title_full_unstemmed Familial Vitamin D-dependent rickets Type 2A: A report of two cases with alopecia and oral manifestations
title_short Familial Vitamin D-dependent rickets Type 2A: A report of two cases with alopecia and oral manifestations
title_sort familial vitamin d-dependent rickets type 2a: a report of two cases with alopecia and oral manifestations
topic Case Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6421925/
https://www.ncbi.nlm.nih.gov/pubmed/30967742
http://dx.doi.org/10.4103/jomfp.JOMFP_309_18
work_keys_str_mv AT thakurmoni familialvitaminddependentricketstype2aareportoftwocaseswithalopeciaandoralmanifestations