Cargando…
Bone marrow-derived mesenchymal stem cells promote colorectal cancer progression via CCR5
Mesenchymal stem cells (MSCs) are recruited from BM to the stroma of developing tumors, where they serve as critical components of the tumor microenvironment by secreting growth factors, cytokines, and chemokines. The role of MSCs in colorectal cancer (CRC) progression was controversial. In this stu...
Autores principales: | , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group UK
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6424976/ https://www.ncbi.nlm.nih.gov/pubmed/30890699 http://dx.doi.org/10.1038/s41419-019-1508-2 |
_version_ | 1783404757034991616 |
---|---|
author | Nishikawa, Gen Kawada, Kenji Nakagawa, Jun Toda, Kosuke Ogawa, Ryotaro Inamoto, Susumu Mizuno, Rei Itatani, Yoshiro Sakai, Yoshiharu |
author_facet | Nishikawa, Gen Kawada, Kenji Nakagawa, Jun Toda, Kosuke Ogawa, Ryotaro Inamoto, Susumu Mizuno, Rei Itatani, Yoshiro Sakai, Yoshiharu |
author_sort | Nishikawa, Gen |
collection | PubMed |
description | Mesenchymal stem cells (MSCs) are recruited from BM to the stroma of developing tumors, where they serve as critical components of the tumor microenvironment by secreting growth factors, cytokines, and chemokines. The role of MSCs in colorectal cancer (CRC) progression was controversial. In this study, we found that C-C chemokine receptor type 5 (CCR5) ligands (i.e., C-C motif chemokine ligand 3 (CCL3), CCL4, and CCL5) were highly produced from MSCs using a chemokine array screening with conditioned media from the cultured human MSCs. A relatively strong CCR5 expression could be detected within the cytoplasm of several CRC cell lines. Regarding the effect of MSC, we found that the xenografts in which CCR5-overexpressing HCT116 cells were inoculated into immunocompromised mice were highly promoted in vivo by a mixture with MSCs. Notably, the CCR5 inhibitor, maraviroc, significantly abolished the MSC-induced tumor growth in vivo. In human clinical specimens (n = 89), 20 cases (29%) were high for CCR5, whereas 69 cases (71%) were low. Statistical analyses indicated that CCR5 expression in primary CRC was associated with CRC patients’ prognosis. Especially, stage III/IV patients with CCR5-high CRCs exhibited a significantly poorer prognosis than those with CCR5-low CRCs. Furthermore, we investigated the effects of preoperative serum CCR5 ligands on patients’ prognosis (n = 114), and found that CRC patients with high serum levels of CCL3 and CCL4 exhibited a poorer prognosis compared to those with low levels of CCL3 and CCL4, while there was no association between CCL5 and prognosis. These results suggest that the inhibition of MSC–CRC interaction by a CCR5 inhibitor could provide the possibility of a novel therapeutic strategy for CRC, and that serum levels of CCL3 and CCL4 could be predictive biomarkers for the prognosis of CRC patients. |
format | Online Article Text |
id | pubmed-6424976 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | Nature Publishing Group UK |
record_format | MEDLINE/PubMed |
spelling | pubmed-64249762019-03-20 Bone marrow-derived mesenchymal stem cells promote colorectal cancer progression via CCR5 Nishikawa, Gen Kawada, Kenji Nakagawa, Jun Toda, Kosuke Ogawa, Ryotaro Inamoto, Susumu Mizuno, Rei Itatani, Yoshiro Sakai, Yoshiharu Cell Death Dis Article Mesenchymal stem cells (MSCs) are recruited from BM to the stroma of developing tumors, where they serve as critical components of the tumor microenvironment by secreting growth factors, cytokines, and chemokines. The role of MSCs in colorectal cancer (CRC) progression was controversial. In this study, we found that C-C chemokine receptor type 5 (CCR5) ligands (i.e., C-C motif chemokine ligand 3 (CCL3), CCL4, and CCL5) were highly produced from MSCs using a chemokine array screening with conditioned media from the cultured human MSCs. A relatively strong CCR5 expression could be detected within the cytoplasm of several CRC cell lines. Regarding the effect of MSC, we found that the xenografts in which CCR5-overexpressing HCT116 cells were inoculated into immunocompromised mice were highly promoted in vivo by a mixture with MSCs. Notably, the CCR5 inhibitor, maraviroc, significantly abolished the MSC-induced tumor growth in vivo. In human clinical specimens (n = 89), 20 cases (29%) were high for CCR5, whereas 69 cases (71%) were low. Statistical analyses indicated that CCR5 expression in primary CRC was associated with CRC patients’ prognosis. Especially, stage III/IV patients with CCR5-high CRCs exhibited a significantly poorer prognosis than those with CCR5-low CRCs. Furthermore, we investigated the effects of preoperative serum CCR5 ligands on patients’ prognosis (n = 114), and found that CRC patients with high serum levels of CCL3 and CCL4 exhibited a poorer prognosis compared to those with low levels of CCL3 and CCL4, while there was no association between CCL5 and prognosis. These results suggest that the inhibition of MSC–CRC interaction by a CCR5 inhibitor could provide the possibility of a novel therapeutic strategy for CRC, and that serum levels of CCL3 and CCL4 could be predictive biomarkers for the prognosis of CRC patients. Nature Publishing Group UK 2019-03-19 /pmc/articles/PMC6424976/ /pubmed/30890699 http://dx.doi.org/10.1038/s41419-019-1508-2 Text en © The Author(s) 2019 Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/. |
spellingShingle | Article Nishikawa, Gen Kawada, Kenji Nakagawa, Jun Toda, Kosuke Ogawa, Ryotaro Inamoto, Susumu Mizuno, Rei Itatani, Yoshiro Sakai, Yoshiharu Bone marrow-derived mesenchymal stem cells promote colorectal cancer progression via CCR5 |
title | Bone marrow-derived mesenchymal stem cells promote colorectal cancer progression via CCR5 |
title_full | Bone marrow-derived mesenchymal stem cells promote colorectal cancer progression via CCR5 |
title_fullStr | Bone marrow-derived mesenchymal stem cells promote colorectal cancer progression via CCR5 |
title_full_unstemmed | Bone marrow-derived mesenchymal stem cells promote colorectal cancer progression via CCR5 |
title_short | Bone marrow-derived mesenchymal stem cells promote colorectal cancer progression via CCR5 |
title_sort | bone marrow-derived mesenchymal stem cells promote colorectal cancer progression via ccr5 |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6424976/ https://www.ncbi.nlm.nih.gov/pubmed/30890699 http://dx.doi.org/10.1038/s41419-019-1508-2 |
work_keys_str_mv | AT nishikawagen bonemarrowderivedmesenchymalstemcellspromotecolorectalcancerprogressionviaccr5 AT kawadakenji bonemarrowderivedmesenchymalstemcellspromotecolorectalcancerprogressionviaccr5 AT nakagawajun bonemarrowderivedmesenchymalstemcellspromotecolorectalcancerprogressionviaccr5 AT todakosuke bonemarrowderivedmesenchymalstemcellspromotecolorectalcancerprogressionviaccr5 AT ogawaryotaro bonemarrowderivedmesenchymalstemcellspromotecolorectalcancerprogressionviaccr5 AT inamotosusumu bonemarrowderivedmesenchymalstemcellspromotecolorectalcancerprogressionviaccr5 AT mizunorei bonemarrowderivedmesenchymalstemcellspromotecolorectalcancerprogressionviaccr5 AT itataniyoshiro bonemarrowderivedmesenchymalstemcellspromotecolorectalcancerprogressionviaccr5 AT sakaiyoshiharu bonemarrowderivedmesenchymalstemcellspromotecolorectalcancerprogressionviaccr5 |