Cargando…
Dinuclear manganese alkoxide complexes as catalysts for C–N bond cleavage of simple tertiary N,N-dialkylamides to give esters
Amide bonds are stable due to the resonance between the nitrogen lone pair and the carbonyl moiety, and therefore the chemical transformation of amides, especially tertiary amides, involving C–N bond fission is considered one of the most difficult organic reactions, unavoidably requiring harsh react...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Royal Society of Chemistry
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6429592/ https://www.ncbi.nlm.nih.gov/pubmed/30996863 http://dx.doi.org/10.1039/c8sc05819a |
_version_ | 1783405623129407488 |
---|---|
author | Nagae, Haruki Hirai, Takahiro Kato, Daiki Soma, Shusei Akebi, Shin-ya Mashima, Kazushi |
author_facet | Nagae, Haruki Hirai, Takahiro Kato, Daiki Soma, Shusei Akebi, Shin-ya Mashima, Kazushi |
author_sort | Nagae, Haruki |
collection | PubMed |
description | Amide bonds are stable due to the resonance between the nitrogen lone pair and the carbonyl moiety, and therefore the chemical transformation of amides, especially tertiary amides, involving C–N bond fission is considered one of the most difficult organic reactions, unavoidably requiring harsh reaction conditions and strong acids or bases. We report the catalytic C–N bond cleavage of simple tertiary N,N-dialkylamides to give corresponding esters using a catalyst system (2 mol% based on Mn atoms) of a tetranuclear manganese alkoxide, [Mn(acac)(OEt)(EtOH)](4) (1c), combined with four equivalents of 4,7-bis(dimethylamino)-1,10-phenanthroline (L1: Me(2)N-Phen). Regarding the reaction mechanism, we isolated a dinuclear manganese complex, [Mn(acac)(OEt)(Phen)](2) (6c), which was revealed as the catalytically active species for the esterification of tertiary amides. |
format | Online Article Text |
id | pubmed-6429592 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | Royal Society of Chemistry |
record_format | MEDLINE/PubMed |
spelling | pubmed-64295922019-04-17 Dinuclear manganese alkoxide complexes as catalysts for C–N bond cleavage of simple tertiary N,N-dialkylamides to give esters Nagae, Haruki Hirai, Takahiro Kato, Daiki Soma, Shusei Akebi, Shin-ya Mashima, Kazushi Chem Sci Chemistry Amide bonds are stable due to the resonance between the nitrogen lone pair and the carbonyl moiety, and therefore the chemical transformation of amides, especially tertiary amides, involving C–N bond fission is considered one of the most difficult organic reactions, unavoidably requiring harsh reaction conditions and strong acids or bases. We report the catalytic C–N bond cleavage of simple tertiary N,N-dialkylamides to give corresponding esters using a catalyst system (2 mol% based on Mn atoms) of a tetranuclear manganese alkoxide, [Mn(acac)(OEt)(EtOH)](4) (1c), combined with four equivalents of 4,7-bis(dimethylamino)-1,10-phenanthroline (L1: Me(2)N-Phen). Regarding the reaction mechanism, we isolated a dinuclear manganese complex, [Mn(acac)(OEt)(Phen)](2) (6c), which was revealed as the catalytically active species for the esterification of tertiary amides. Royal Society of Chemistry 2019-01-29 /pmc/articles/PMC6429592/ /pubmed/30996863 http://dx.doi.org/10.1039/c8sc05819a Text en This journal is © The Royal Society of Chemistry 2019 http://creativecommons.org/licenses/by-nc/3.0/ This article is freely available. This article is licensed under a Creative Commons Attribution Non Commercial 3.0 Unported Licence (CC BY-NC 3.0) |
spellingShingle | Chemistry Nagae, Haruki Hirai, Takahiro Kato, Daiki Soma, Shusei Akebi, Shin-ya Mashima, Kazushi Dinuclear manganese alkoxide complexes as catalysts for C–N bond cleavage of simple tertiary N,N-dialkylamides to give esters |
title | Dinuclear manganese alkoxide complexes as catalysts for C–N bond cleavage of simple tertiary N,N-dialkylamides to give esters
|
title_full | Dinuclear manganese alkoxide complexes as catalysts for C–N bond cleavage of simple tertiary N,N-dialkylamides to give esters
|
title_fullStr | Dinuclear manganese alkoxide complexes as catalysts for C–N bond cleavage of simple tertiary N,N-dialkylamides to give esters
|
title_full_unstemmed | Dinuclear manganese alkoxide complexes as catalysts for C–N bond cleavage of simple tertiary N,N-dialkylamides to give esters
|
title_short | Dinuclear manganese alkoxide complexes as catalysts for C–N bond cleavage of simple tertiary N,N-dialkylamides to give esters
|
title_sort | dinuclear manganese alkoxide complexes as catalysts for c–n bond cleavage of simple tertiary n,n-dialkylamides to give esters |
topic | Chemistry |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6429592/ https://www.ncbi.nlm.nih.gov/pubmed/30996863 http://dx.doi.org/10.1039/c8sc05819a |
work_keys_str_mv | AT nagaeharuki dinuclearmanganesealkoxidecomplexesascatalystsforcnbondcleavageofsimpletertiarynndialkylamidestogiveesters AT hiraitakahiro dinuclearmanganesealkoxidecomplexesascatalystsforcnbondcleavageofsimpletertiarynndialkylamidestogiveesters AT katodaiki dinuclearmanganesealkoxidecomplexesascatalystsforcnbondcleavageofsimpletertiarynndialkylamidestogiveesters AT somashusei dinuclearmanganesealkoxidecomplexesascatalystsforcnbondcleavageofsimpletertiarynndialkylamidestogiveesters AT akebishinya dinuclearmanganesealkoxidecomplexesascatalystsforcnbondcleavageofsimpletertiarynndialkylamidestogiveesters AT mashimakazushi dinuclearmanganesealkoxidecomplexesascatalystsforcnbondcleavageofsimpletertiarynndialkylamidestogiveesters |