Cargando…

Dinuclear manganese alkoxide complexes as catalysts for C–N bond cleavage of simple tertiary N,N-dialkylamides to give esters

Amide bonds are stable due to the resonance between the nitrogen lone pair and the carbonyl moiety, and therefore the chemical transformation of amides, especially tertiary amides, involving C–N bond fission is considered one of the most difficult organic reactions, unavoidably requiring harsh react...

Descripción completa

Detalles Bibliográficos
Autores principales: Nagae, Haruki, Hirai, Takahiro, Kato, Daiki, Soma, Shusei, Akebi, Shin-ya, Mashima, Kazushi
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Royal Society of Chemistry 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6429592/
https://www.ncbi.nlm.nih.gov/pubmed/30996863
http://dx.doi.org/10.1039/c8sc05819a
_version_ 1783405623129407488
author Nagae, Haruki
Hirai, Takahiro
Kato, Daiki
Soma, Shusei
Akebi, Shin-ya
Mashima, Kazushi
author_facet Nagae, Haruki
Hirai, Takahiro
Kato, Daiki
Soma, Shusei
Akebi, Shin-ya
Mashima, Kazushi
author_sort Nagae, Haruki
collection PubMed
description Amide bonds are stable due to the resonance between the nitrogen lone pair and the carbonyl moiety, and therefore the chemical transformation of amides, especially tertiary amides, involving C–N bond fission is considered one of the most difficult organic reactions, unavoidably requiring harsh reaction conditions and strong acids or bases. We report the catalytic C–N bond cleavage of simple tertiary N,N-dialkylamides to give corresponding esters using a catalyst system (2 mol% based on Mn atoms) of a tetranuclear manganese alkoxide, [Mn(acac)(OEt)(EtOH)](4) (1c), combined with four equivalents of 4,7-bis(dimethylamino)-1,10-phenanthroline (L1: Me(2)N-Phen). Regarding the reaction mechanism, we isolated a dinuclear manganese complex, [Mn(acac)(OEt)(Phen)](2) (6c), which was revealed as the catalytically active species for the esterification of tertiary amides.
format Online
Article
Text
id pubmed-6429592
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher Royal Society of Chemistry
record_format MEDLINE/PubMed
spelling pubmed-64295922019-04-17 Dinuclear manganese alkoxide complexes as catalysts for C–N bond cleavage of simple tertiary N,N-dialkylamides to give esters Nagae, Haruki Hirai, Takahiro Kato, Daiki Soma, Shusei Akebi, Shin-ya Mashima, Kazushi Chem Sci Chemistry Amide bonds are stable due to the resonance between the nitrogen lone pair and the carbonyl moiety, and therefore the chemical transformation of amides, especially tertiary amides, involving C–N bond fission is considered one of the most difficult organic reactions, unavoidably requiring harsh reaction conditions and strong acids or bases. We report the catalytic C–N bond cleavage of simple tertiary N,N-dialkylamides to give corresponding esters using a catalyst system (2 mol% based on Mn atoms) of a tetranuclear manganese alkoxide, [Mn(acac)(OEt)(EtOH)](4) (1c), combined with four equivalents of 4,7-bis(dimethylamino)-1,10-phenanthroline (L1: Me(2)N-Phen). Regarding the reaction mechanism, we isolated a dinuclear manganese complex, [Mn(acac)(OEt)(Phen)](2) (6c), which was revealed as the catalytically active species for the esterification of tertiary amides. Royal Society of Chemistry 2019-01-29 /pmc/articles/PMC6429592/ /pubmed/30996863 http://dx.doi.org/10.1039/c8sc05819a Text en This journal is © The Royal Society of Chemistry 2019 http://creativecommons.org/licenses/by-nc/3.0/ This article is freely available. This article is licensed under a Creative Commons Attribution Non Commercial 3.0 Unported Licence (CC BY-NC 3.0)
spellingShingle Chemistry
Nagae, Haruki
Hirai, Takahiro
Kato, Daiki
Soma, Shusei
Akebi, Shin-ya
Mashima, Kazushi
Dinuclear manganese alkoxide complexes as catalysts for C–N bond cleavage of simple tertiary N,N-dialkylamides to give esters
title Dinuclear manganese alkoxide complexes as catalysts for C–N bond cleavage of simple tertiary N,N-dialkylamides to give esters
title_full Dinuclear manganese alkoxide complexes as catalysts for C–N bond cleavage of simple tertiary N,N-dialkylamides to give esters
title_fullStr Dinuclear manganese alkoxide complexes as catalysts for C–N bond cleavage of simple tertiary N,N-dialkylamides to give esters
title_full_unstemmed Dinuclear manganese alkoxide complexes as catalysts for C–N bond cleavage of simple tertiary N,N-dialkylamides to give esters
title_short Dinuclear manganese alkoxide complexes as catalysts for C–N bond cleavage of simple tertiary N,N-dialkylamides to give esters
title_sort dinuclear manganese alkoxide complexes as catalysts for c–n bond cleavage of simple tertiary n,n-dialkylamides to give esters
topic Chemistry
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6429592/
https://www.ncbi.nlm.nih.gov/pubmed/30996863
http://dx.doi.org/10.1039/c8sc05819a
work_keys_str_mv AT nagaeharuki dinuclearmanganesealkoxidecomplexesascatalystsforcnbondcleavageofsimpletertiarynndialkylamidestogiveesters
AT hiraitakahiro dinuclearmanganesealkoxidecomplexesascatalystsforcnbondcleavageofsimpletertiarynndialkylamidestogiveesters
AT katodaiki dinuclearmanganesealkoxidecomplexesascatalystsforcnbondcleavageofsimpletertiarynndialkylamidestogiveesters
AT somashusei dinuclearmanganesealkoxidecomplexesascatalystsforcnbondcleavageofsimpletertiarynndialkylamidestogiveesters
AT akebishinya dinuclearmanganesealkoxidecomplexesascatalystsforcnbondcleavageofsimpletertiarynndialkylamidestogiveesters
AT mashimakazushi dinuclearmanganesealkoxidecomplexesascatalystsforcnbondcleavageofsimpletertiarynndialkylamidestogiveesters