Complete Genome Sequence of Spiroplasma phoeniceum Strain P40(T), a Plant Pathogen Isolated from Diseased Plants of Madagascar Periwinkle [Catharanthus roseus (L.) G. Don]

The phytopathogen Spiroplasma phoeniceum was isolated from diseased plants of Madagascar periwinkle [Catharanthus roseus (L.) G. Don]. Here, we report the nucleotide sequence of the 1,791,576-bp circular chromosome and three plasmids of strain P40(T). This information serves as a resource for compar...

Descripción completa

Detalles Bibliográficos
Autores principales: Davis, Robert E., Shao, Jonathan, Zhao, Yan, Wei, Wei, Bottner-Parker, Kristi, Silver, Aliyah, Stump, Zoey, Gasparich, Gail E., Donofrio, Nicole
Formato: Online Artículo Texto
Lenguaje:English
Publicado: American Society for Microbiology 2019
Materias:
Genome Sequences
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6430324/
https://www.ncbi.nlm.nih.gov/pubmed/30938707
http://dx.doi.org/10.1128/MRA.01612-18
_version_ 1783405755408318464
author Davis, Robert E.
Shao, Jonathan
Zhao, Yan
Wei, Wei
Bottner-Parker, Kristi
Silver, Aliyah
Stump, Zoey
Gasparich, Gail E.
Donofrio, Nicole
author_facet Davis, Robert E.
Shao, Jonathan
Zhao, Yan
Wei, Wei
Bottner-Parker, Kristi
Silver, Aliyah
Stump, Zoey
Gasparich, Gail E.
Donofrio, Nicole
author_sort Davis, Robert E.
collection PubMed
description The phytopathogen Spiroplasma phoeniceum was isolated from diseased plants of Madagascar periwinkle [Catharanthus roseus (L.) G. Don]. Here, we report the nucleotide sequence of the 1,791,576-bp circular chromosome and three plasmids of strain P40(T). This information serves as a resource for comparative analyses of spiroplasmal adaptations to diverse ecological niches.
format Online
Article
Text
id pubmed-6430324
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher American Society for Microbiology
record_format MEDLINE/PubMed
spelling pubmed-64303242019-04-12 Complete Genome Sequence of Spiroplasma phoeniceum Strain P40(T), a Plant Pathogen Isolated from Diseased Plants of Madagascar Periwinkle [Catharanthus roseus (L.) G. Don] Davis, Robert E. Shao, Jonathan Zhao, Yan Wei, Wei Bottner-Parker, Kristi Silver, Aliyah Stump, Zoey Gasparich, Gail E. Donofrio, Nicole Microbiol Resour Announc Genome Sequences The phytopathogen Spiroplasma phoeniceum was isolated from diseased plants of Madagascar periwinkle [Catharanthus roseus (L.) G. Don]. Here, we report the nucleotide sequence of the 1,791,576-bp circular chromosome and three plasmids of strain P40(T). This information serves as a resource for comparative analyses of spiroplasmal adaptations to diverse ecological niches. American Society for Microbiology 2019-03-21 /pmc/articles/PMC6430324/ /pubmed/30938707 http://dx.doi.org/10.1128/MRA.01612-18 Text en https://doi.org/10.1128/AuthorWarrantyLicense.v1 This is a work of the U.S. Government and is not subject to copyright protection in the United States. Foreign copyrights may apply.
spellingShingle Genome Sequences
Davis, Robert E.
Shao, Jonathan
Zhao, Yan
Wei, Wei
Bottner-Parker, Kristi
Silver, Aliyah
Stump, Zoey
Gasparich, Gail E.
Donofrio, Nicole
Complete Genome Sequence of Spiroplasma phoeniceum Strain P40(T), a Plant Pathogen Isolated from Diseased Plants of Madagascar Periwinkle [Catharanthus roseus (L.) G. Don]
title Complete Genome Sequence of Spiroplasma phoeniceum Strain P40(T), a Plant Pathogen Isolated from Diseased Plants of Madagascar Periwinkle [Catharanthus roseus (L.) G. Don]
title_full Complete Genome Sequence of Spiroplasma phoeniceum Strain P40(T), a Plant Pathogen Isolated from Diseased Plants of Madagascar Periwinkle [Catharanthus roseus (L.) G. Don]
title_fullStr Complete Genome Sequence of Spiroplasma phoeniceum Strain P40(T), a Plant Pathogen Isolated from Diseased Plants of Madagascar Periwinkle [Catharanthus roseus (L.) G. Don]
title_full_unstemmed Complete Genome Sequence of Spiroplasma phoeniceum Strain P40(T), a Plant Pathogen Isolated from Diseased Plants of Madagascar Periwinkle [Catharanthus roseus (L.) G. Don]
title_short Complete Genome Sequence of Spiroplasma phoeniceum Strain P40(T), a Plant Pathogen Isolated from Diseased Plants of Madagascar Periwinkle [Catharanthus roseus (L.) G. Don]
title_sort complete genome sequence of spiroplasma phoeniceum strain p40(t), a plant pathogen isolated from diseased plants of madagascar periwinkle [catharanthus roseus (l.) g. don]
topic Genome Sequences
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6430324/
https://www.ncbi.nlm.nih.gov/pubmed/30938707
http://dx.doi.org/10.1128/MRA.01612-18
work_keys_str_mv AT davisroberte completegenomesequenceofspiroplasmaphoeniceumstrainp40taplantpathogenisolatedfromdiseasedplantsofmadagascarperiwinklecatharanthusroseuslgdon
AT shaojonathan completegenomesequenceofspiroplasmaphoeniceumstrainp40taplantpathogenisolatedfromdiseasedplantsofmadagascarperiwinklecatharanthusroseuslgdon
AT zhaoyan completegenomesequenceofspiroplasmaphoeniceumstrainp40taplantpathogenisolatedfromdiseasedplantsofmadagascarperiwinklecatharanthusroseuslgdon
AT weiwei completegenomesequenceofspiroplasmaphoeniceumstrainp40taplantpathogenisolatedfromdiseasedplantsofmadagascarperiwinklecatharanthusroseuslgdon
AT bottnerparkerkristi completegenomesequenceofspiroplasmaphoeniceumstrainp40taplantpathogenisolatedfromdiseasedplantsofmadagascarperiwinklecatharanthusroseuslgdon
AT silveraliyah completegenomesequenceofspiroplasmaphoeniceumstrainp40taplantpathogenisolatedfromdiseasedplantsofmadagascarperiwinklecatharanthusroseuslgdon
AT stumpzoey completegenomesequenceofspiroplasmaphoeniceumstrainp40taplantpathogenisolatedfromdiseasedplantsofmadagascarperiwinklecatharanthusroseuslgdon
AT gasparichgaile completegenomesequenceofspiroplasmaphoeniceumstrainp40taplantpathogenisolatedfromdiseasedplantsofmadagascarperiwinklecatharanthusroseuslgdon
AT donofrionicole completegenomesequenceofspiroplasmaphoeniceumstrainp40taplantpathogenisolatedfromdiseasedplantsofmadagascarperiwinklecatharanthusroseuslgdon

Ejemplares similares