Cargando…
LncRNA XIST mediates bovine mammary epithelial cell inflammatory response via NF‐κB/NLRP3 inflammasome pathway
OBJECTIVES: The correlations between long non‐coding RNAs (lncRNAs) and diverse mammal diseases have been clarified by many researches, but the cognition about bovine mastitis‐related lncRNAs remains limited. This study aimed to investigate the potential role of lncRNA X‐inactive specific transcript...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
John Wiley and Sons Inc.
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6430464/ https://www.ncbi.nlm.nih.gov/pubmed/30362186 http://dx.doi.org/10.1111/cpr.12525 |
_version_ | 1783405778190729216 |
---|---|
author | Ma, Mengru Pei, Yifei Wang, Xixi Feng, Jiaxin Zhang, Yong Gao, Ming‐Qing |
author_facet | Ma, Mengru Pei, Yifei Wang, Xixi Feng, Jiaxin Zhang, Yong Gao, Ming‐Qing |
author_sort | Ma, Mengru |
collection | PubMed |
description | OBJECTIVES: The correlations between long non‐coding RNAs (lncRNAs) and diverse mammal diseases have been clarified by many researches, but the cognition about bovine mastitis‐related lncRNAs remains limited. This study aimed to investigate the potential role of lncRNA X‐inactive specific transcript (XIST) in the inflammatory response of bovine mammary epithelial cells. MATERIALS AND METHODS: Two inflammatory bovine mammary alveolar cell‐T (MAC‐T) models were established by infecting the cells with Escherichia coli (E. coli) and Staphylococcus aureus (S. aureus). The expressions of pro‐inflammatory cytokines were measured, and the proliferation, viability and apoptosis of the inflammatory cells were evaluated after XIST was knocked down by an siRNA. The relationship among XIST, NF‐κB pathway and NOD‐like receptor protein 3 (NLRP3) inflammasome was investigated using an inhibitor of NF‐κB signal pathway. RESULTS: The expression of XIST was abnormally increased in bovine mastitic tissues and inflammatory MAC‐T cells. Silencing of XIST significantly increased the expression of E. coli or S. aureus‐induced pro‐inflammatory cytokines. Additionally, knockdown of XIST could inhibit cell proliferation, suppress cell viability and promote cell apoptosis under inflammatory conditions. Furthermore, XIST inhibited E. coli or S. aureus‐induced NF‐κB phosphorylation and the production of NLRP3 inflammasome. CONCLUSIONS: The expression of XIST was promoted by activated NF‐κB pathway and, in turn, XIST generated a negative feedback loop to regulate NF‐κB/NLRP3 inflammasome pathway for mediating the process of inflammation. |
format | Online Article Text |
id | pubmed-6430464 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | John Wiley and Sons Inc. |
record_format | MEDLINE/PubMed |
spelling | pubmed-64304642020-03-13 LncRNA XIST mediates bovine mammary epithelial cell inflammatory response via NF‐κB/NLRP3 inflammasome pathway Ma, Mengru Pei, Yifei Wang, Xixi Feng, Jiaxin Zhang, Yong Gao, Ming‐Qing Cell Prolif Original Articles OBJECTIVES: The correlations between long non‐coding RNAs (lncRNAs) and diverse mammal diseases have been clarified by many researches, but the cognition about bovine mastitis‐related lncRNAs remains limited. This study aimed to investigate the potential role of lncRNA X‐inactive specific transcript (XIST) in the inflammatory response of bovine mammary epithelial cells. MATERIALS AND METHODS: Two inflammatory bovine mammary alveolar cell‐T (MAC‐T) models were established by infecting the cells with Escherichia coli (E. coli) and Staphylococcus aureus (S. aureus). The expressions of pro‐inflammatory cytokines were measured, and the proliferation, viability and apoptosis of the inflammatory cells were evaluated after XIST was knocked down by an siRNA. The relationship among XIST, NF‐κB pathway and NOD‐like receptor protein 3 (NLRP3) inflammasome was investigated using an inhibitor of NF‐κB signal pathway. RESULTS: The expression of XIST was abnormally increased in bovine mastitic tissues and inflammatory MAC‐T cells. Silencing of XIST significantly increased the expression of E. coli or S. aureus‐induced pro‐inflammatory cytokines. Additionally, knockdown of XIST could inhibit cell proliferation, suppress cell viability and promote cell apoptosis under inflammatory conditions. Furthermore, XIST inhibited E. coli or S. aureus‐induced NF‐κB phosphorylation and the production of NLRP3 inflammasome. CONCLUSIONS: The expression of XIST was promoted by activated NF‐κB pathway and, in turn, XIST generated a negative feedback loop to regulate NF‐κB/NLRP3 inflammasome pathway for mediating the process of inflammation. John Wiley and Sons Inc. 2018-10-25 /pmc/articles/PMC6430464/ /pubmed/30362186 http://dx.doi.org/10.1111/cpr.12525 Text en © 2018 The Authors. Cell Proliferation Published by John Wiley & Sons Ltd This is an open access article under the terms of the http://creativecommons.org/licenses/by/4.0/ License, which permits use, distribution and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Original Articles Ma, Mengru Pei, Yifei Wang, Xixi Feng, Jiaxin Zhang, Yong Gao, Ming‐Qing LncRNA XIST mediates bovine mammary epithelial cell inflammatory response via NF‐κB/NLRP3 inflammasome pathway |
title | LncRNA XIST mediates bovine mammary epithelial cell inflammatory response via NF‐κB/NLRP3 inflammasome pathway |
title_full | LncRNA XIST mediates bovine mammary epithelial cell inflammatory response via NF‐κB/NLRP3 inflammasome pathway |
title_fullStr | LncRNA XIST mediates bovine mammary epithelial cell inflammatory response via NF‐κB/NLRP3 inflammasome pathway |
title_full_unstemmed | LncRNA XIST mediates bovine mammary epithelial cell inflammatory response via NF‐κB/NLRP3 inflammasome pathway |
title_short | LncRNA XIST mediates bovine mammary epithelial cell inflammatory response via NF‐κB/NLRP3 inflammasome pathway |
title_sort | lncrna xist mediates bovine mammary epithelial cell inflammatory response via nf‐κb/nlrp3 inflammasome pathway |
topic | Original Articles |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6430464/ https://www.ncbi.nlm.nih.gov/pubmed/30362186 http://dx.doi.org/10.1111/cpr.12525 |
work_keys_str_mv | AT mamengru lncrnaxistmediatesbovinemammaryepithelialcellinflammatoryresponsevianfkbnlrp3inflammasomepathway AT peiyifei lncrnaxistmediatesbovinemammaryepithelialcellinflammatoryresponsevianfkbnlrp3inflammasomepathway AT wangxixi lncrnaxistmediatesbovinemammaryepithelialcellinflammatoryresponsevianfkbnlrp3inflammasomepathway AT fengjiaxin lncrnaxistmediatesbovinemammaryepithelialcellinflammatoryresponsevianfkbnlrp3inflammasomepathway AT zhangyong lncrnaxistmediatesbovinemammaryepithelialcellinflammatoryresponsevianfkbnlrp3inflammasomepathway AT gaomingqing lncrnaxistmediatesbovinemammaryepithelialcellinflammatoryresponsevianfkbnlrp3inflammasomepathway |