Cargando…

Association of the hypertriglyceridemic waist phenotype and severity of acute pancreatitis

BACKGROUND: The aim of this study was to evaluate the effect of a simple visceral obesity phenotype, known as the hypertriglyceridemic waist phenotype and its quantitative indicator waist circumference index on the severity of acute pancreatitis. MATERIALS AND METHODS: Diagnosis and severity analysi...

Descripción completa

Detalles Bibliográficos
Autores principales: Ding, Yanbing, Zhang, Min, Wang, Lisheng, Yin, Tao, Wang, Ningzhi, Wu, Jian, Zhi, Jiehua, Chen, Weiwei, Wu, Keyan, Gong, Weijuan, Xiao, Weiming, Xu, Zhenglei, Lu, Guotao
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6454768/
https://www.ncbi.nlm.nih.gov/pubmed/30961653
http://dx.doi.org/10.1186/s12944-019-1019-2
_version_ 1783409607761199104
author Ding, Yanbing
Zhang, Min
Wang, Lisheng
Yin, Tao
Wang, Ningzhi
Wu, Jian
Zhi, Jiehua
Chen, Weiwei
Wu, Keyan
Gong, Weijuan
Xiao, Weiming
Xu, Zhenglei
Lu, Guotao
author_facet Ding, Yanbing
Zhang, Min
Wang, Lisheng
Yin, Tao
Wang, Ningzhi
Wu, Jian
Zhi, Jiehua
Chen, Weiwei
Wu, Keyan
Gong, Weijuan
Xiao, Weiming
Xu, Zhenglei
Lu, Guotao
author_sort Ding, Yanbing
collection PubMed
description BACKGROUND: The aim of this study was to evaluate the effect of a simple visceral obesity phenotype, known as the hypertriglyceridemic waist phenotype and its quantitative indicator waist circumference index on the severity of acute pancreatitis. MATERIALS AND METHODS: Diagnosis and severity analysis of acute pancreatitis were determined according to the Atlanta classification guidelines, revised in 2012. We considered the hypertriglyceridemic waist phenotype as characterized by increased waist circumference and elevated triglyceride concentrations. We investigated the association between the acute pancreatitis severity and hypertriglyceridemic waist phenotype, including waist circumference index. RESULTS: The hypertriglyceridemic waist phenotype was significantly associated with systemic inflammatory response syndrome, organ failure, and severe acute pancreatitis. The median waist circumference index and demonstration of hypertriglyceridemic waist phenotype were positively correlated with acute pancreatitis severity. In addition, multivariate logistic analysis showed that patients with the hypertriglyceridemic waist phenotype had 1.664 times the risk of organ failure and 1.891 times the risk of systemic inflammatory response syndrome, compared with the other groups. CONCLUSION: Upon admission, the hypertriglyceridemic waist phenotype was strongly associated with acute pancreatitis in patients. This phenotype, including waist circumference index, might be a simple method for evaluating individuals at high risk of severe acute pancreatitis. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12944-019-1019-2) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-6454768
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-64547682019-04-19 Association of the hypertriglyceridemic waist phenotype and severity of acute pancreatitis Ding, Yanbing Zhang, Min Wang, Lisheng Yin, Tao Wang, Ningzhi Wu, Jian Zhi, Jiehua Chen, Weiwei Wu, Keyan Gong, Weijuan Xiao, Weiming Xu, Zhenglei Lu, Guotao Lipids Health Dis Research BACKGROUND: The aim of this study was to evaluate the effect of a simple visceral obesity phenotype, known as the hypertriglyceridemic waist phenotype and its quantitative indicator waist circumference index on the severity of acute pancreatitis. MATERIALS AND METHODS: Diagnosis and severity analysis of acute pancreatitis were determined according to the Atlanta classification guidelines, revised in 2012. We considered the hypertriglyceridemic waist phenotype as characterized by increased waist circumference and elevated triglyceride concentrations. We investigated the association between the acute pancreatitis severity and hypertriglyceridemic waist phenotype, including waist circumference index. RESULTS: The hypertriglyceridemic waist phenotype was significantly associated with systemic inflammatory response syndrome, organ failure, and severe acute pancreatitis. The median waist circumference index and demonstration of hypertriglyceridemic waist phenotype were positively correlated with acute pancreatitis severity. In addition, multivariate logistic analysis showed that patients with the hypertriglyceridemic waist phenotype had 1.664 times the risk of organ failure and 1.891 times the risk of systemic inflammatory response syndrome, compared with the other groups. CONCLUSION: Upon admission, the hypertriglyceridemic waist phenotype was strongly associated with acute pancreatitis in patients. This phenotype, including waist circumference index, might be a simple method for evaluating individuals at high risk of severe acute pancreatitis. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12944-019-1019-2) contains supplementary material, which is available to authorized users. BioMed Central 2019-04-09 /pmc/articles/PMC6454768/ /pubmed/30961653 http://dx.doi.org/10.1186/s12944-019-1019-2 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research
Ding, Yanbing
Zhang, Min
Wang, Lisheng
Yin, Tao
Wang, Ningzhi
Wu, Jian
Zhi, Jiehua
Chen, Weiwei
Wu, Keyan
Gong, Weijuan
Xiao, Weiming
Xu, Zhenglei
Lu, Guotao
Association of the hypertriglyceridemic waist phenotype and severity of acute pancreatitis
title Association of the hypertriglyceridemic waist phenotype and severity of acute pancreatitis
title_full Association of the hypertriglyceridemic waist phenotype and severity of acute pancreatitis
title_fullStr Association of the hypertriglyceridemic waist phenotype and severity of acute pancreatitis
title_full_unstemmed Association of the hypertriglyceridemic waist phenotype and severity of acute pancreatitis
title_short Association of the hypertriglyceridemic waist phenotype and severity of acute pancreatitis
title_sort association of the hypertriglyceridemic waist phenotype and severity of acute pancreatitis
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6454768/
https://www.ncbi.nlm.nih.gov/pubmed/30961653
http://dx.doi.org/10.1186/s12944-019-1019-2
work_keys_str_mv AT dingyanbing associationofthehypertriglyceridemicwaistphenotypeandseverityofacutepancreatitis
AT zhangmin associationofthehypertriglyceridemicwaistphenotypeandseverityofacutepancreatitis
AT wanglisheng associationofthehypertriglyceridemicwaistphenotypeandseverityofacutepancreatitis
AT yintao associationofthehypertriglyceridemicwaistphenotypeandseverityofacutepancreatitis
AT wangningzhi associationofthehypertriglyceridemicwaistphenotypeandseverityofacutepancreatitis
AT wujian associationofthehypertriglyceridemicwaistphenotypeandseverityofacutepancreatitis
AT zhijiehua associationofthehypertriglyceridemicwaistphenotypeandseverityofacutepancreatitis
AT chenweiwei associationofthehypertriglyceridemicwaistphenotypeandseverityofacutepancreatitis
AT wukeyan associationofthehypertriglyceridemicwaistphenotypeandseverityofacutepancreatitis
AT gongweijuan associationofthehypertriglyceridemicwaistphenotypeandseverityofacutepancreatitis
AT xiaoweiming associationofthehypertriglyceridemicwaistphenotypeandseverityofacutepancreatitis
AT xuzhenglei associationofthehypertriglyceridemicwaistphenotypeandseverityofacutepancreatitis
AT luguotao associationofthehypertriglyceridemicwaistphenotypeandseverityofacutepancreatitis