Cargando…
Association of the hypertriglyceridemic waist phenotype and severity of acute pancreatitis
BACKGROUND: The aim of this study was to evaluate the effect of a simple visceral obesity phenotype, known as the hypertriglyceridemic waist phenotype and its quantitative indicator waist circumference index on the severity of acute pancreatitis. MATERIALS AND METHODS: Diagnosis and severity analysi...
Autores principales: | , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6454768/ https://www.ncbi.nlm.nih.gov/pubmed/30961653 http://dx.doi.org/10.1186/s12944-019-1019-2 |
_version_ | 1783409607761199104 |
---|---|
author | Ding, Yanbing Zhang, Min Wang, Lisheng Yin, Tao Wang, Ningzhi Wu, Jian Zhi, Jiehua Chen, Weiwei Wu, Keyan Gong, Weijuan Xiao, Weiming Xu, Zhenglei Lu, Guotao |
author_facet | Ding, Yanbing Zhang, Min Wang, Lisheng Yin, Tao Wang, Ningzhi Wu, Jian Zhi, Jiehua Chen, Weiwei Wu, Keyan Gong, Weijuan Xiao, Weiming Xu, Zhenglei Lu, Guotao |
author_sort | Ding, Yanbing |
collection | PubMed |
description | BACKGROUND: The aim of this study was to evaluate the effect of a simple visceral obesity phenotype, known as the hypertriglyceridemic waist phenotype and its quantitative indicator waist circumference index on the severity of acute pancreatitis. MATERIALS AND METHODS: Diagnosis and severity analysis of acute pancreatitis were determined according to the Atlanta classification guidelines, revised in 2012. We considered the hypertriglyceridemic waist phenotype as characterized by increased waist circumference and elevated triglyceride concentrations. We investigated the association between the acute pancreatitis severity and hypertriglyceridemic waist phenotype, including waist circumference index. RESULTS: The hypertriglyceridemic waist phenotype was significantly associated with systemic inflammatory response syndrome, organ failure, and severe acute pancreatitis. The median waist circumference index and demonstration of hypertriglyceridemic waist phenotype were positively correlated with acute pancreatitis severity. In addition, multivariate logistic analysis showed that patients with the hypertriglyceridemic waist phenotype had 1.664 times the risk of organ failure and 1.891 times the risk of systemic inflammatory response syndrome, compared with the other groups. CONCLUSION: Upon admission, the hypertriglyceridemic waist phenotype was strongly associated with acute pancreatitis in patients. This phenotype, including waist circumference index, might be a simple method for evaluating individuals at high risk of severe acute pancreatitis. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12944-019-1019-2) contains supplementary material, which is available to authorized users. |
format | Online Article Text |
id | pubmed-6454768 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-64547682019-04-19 Association of the hypertriglyceridemic waist phenotype and severity of acute pancreatitis Ding, Yanbing Zhang, Min Wang, Lisheng Yin, Tao Wang, Ningzhi Wu, Jian Zhi, Jiehua Chen, Weiwei Wu, Keyan Gong, Weijuan Xiao, Weiming Xu, Zhenglei Lu, Guotao Lipids Health Dis Research BACKGROUND: The aim of this study was to evaluate the effect of a simple visceral obesity phenotype, known as the hypertriglyceridemic waist phenotype and its quantitative indicator waist circumference index on the severity of acute pancreatitis. MATERIALS AND METHODS: Diagnosis and severity analysis of acute pancreatitis were determined according to the Atlanta classification guidelines, revised in 2012. We considered the hypertriglyceridemic waist phenotype as characterized by increased waist circumference and elevated triglyceride concentrations. We investigated the association between the acute pancreatitis severity and hypertriglyceridemic waist phenotype, including waist circumference index. RESULTS: The hypertriglyceridemic waist phenotype was significantly associated with systemic inflammatory response syndrome, organ failure, and severe acute pancreatitis. The median waist circumference index and demonstration of hypertriglyceridemic waist phenotype were positively correlated with acute pancreatitis severity. In addition, multivariate logistic analysis showed that patients with the hypertriglyceridemic waist phenotype had 1.664 times the risk of organ failure and 1.891 times the risk of systemic inflammatory response syndrome, compared with the other groups. CONCLUSION: Upon admission, the hypertriglyceridemic waist phenotype was strongly associated with acute pancreatitis in patients. This phenotype, including waist circumference index, might be a simple method for evaluating individuals at high risk of severe acute pancreatitis. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s12944-019-1019-2) contains supplementary material, which is available to authorized users. BioMed Central 2019-04-09 /pmc/articles/PMC6454768/ /pubmed/30961653 http://dx.doi.org/10.1186/s12944-019-1019-2 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Ding, Yanbing Zhang, Min Wang, Lisheng Yin, Tao Wang, Ningzhi Wu, Jian Zhi, Jiehua Chen, Weiwei Wu, Keyan Gong, Weijuan Xiao, Weiming Xu, Zhenglei Lu, Guotao Association of the hypertriglyceridemic waist phenotype and severity of acute pancreatitis |
title | Association of the hypertriglyceridemic waist phenotype and severity of acute pancreatitis |
title_full | Association of the hypertriglyceridemic waist phenotype and severity of acute pancreatitis |
title_fullStr | Association of the hypertriglyceridemic waist phenotype and severity of acute pancreatitis |
title_full_unstemmed | Association of the hypertriglyceridemic waist phenotype and severity of acute pancreatitis |
title_short | Association of the hypertriglyceridemic waist phenotype and severity of acute pancreatitis |
title_sort | association of the hypertriglyceridemic waist phenotype and severity of acute pancreatitis |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6454768/ https://www.ncbi.nlm.nih.gov/pubmed/30961653 http://dx.doi.org/10.1186/s12944-019-1019-2 |
work_keys_str_mv | AT dingyanbing associationofthehypertriglyceridemicwaistphenotypeandseverityofacutepancreatitis AT zhangmin associationofthehypertriglyceridemicwaistphenotypeandseverityofacutepancreatitis AT wanglisheng associationofthehypertriglyceridemicwaistphenotypeandseverityofacutepancreatitis AT yintao associationofthehypertriglyceridemicwaistphenotypeandseverityofacutepancreatitis AT wangningzhi associationofthehypertriglyceridemicwaistphenotypeandseverityofacutepancreatitis AT wujian associationofthehypertriglyceridemicwaistphenotypeandseverityofacutepancreatitis AT zhijiehua associationofthehypertriglyceridemicwaistphenotypeandseverityofacutepancreatitis AT chenweiwei associationofthehypertriglyceridemicwaistphenotypeandseverityofacutepancreatitis AT wukeyan associationofthehypertriglyceridemicwaistphenotypeandseverityofacutepancreatitis AT gongweijuan associationofthehypertriglyceridemicwaistphenotypeandseverityofacutepancreatitis AT xiaoweiming associationofthehypertriglyceridemicwaistphenotypeandseverityofacutepancreatitis AT xuzhenglei associationofthehypertriglyceridemicwaistphenotypeandseverityofacutepancreatitis AT luguotao associationofthehypertriglyceridemicwaistphenotypeandseverityofacutepancreatitis |