Cargando…

Neuraminidase activity and specificity of influenza A virus are influenced by haemagglutinin-receptor binding

Influenza virus haemagglutinin (HA) and neuraminidase (NA) are involved in the recognition and modulation of sialic acids on the cell surface as the virus receptor. Although the balance between two proteins functions has been found to be crucial for viral fitness, the interplay between the proteins...

Descripción completa

Detalles Bibliográficos
Autores principales: Lai, Jimmy Chun Cheong, Karunarathna, Herath M. T. K., Wong, Ho Him, Peiris, Joseph S. M., Nicholls, John M.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Taylor & Francis 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6455212/
https://www.ncbi.nlm.nih.gov/pubmed/30866786
http://dx.doi.org/10.1080/22221751.2019.1581034
_version_ 1783409670825705472
author Lai, Jimmy Chun Cheong
Karunarathna, Herath M. T. K.
Wong, Ho Him
Peiris, Joseph S. M.
Nicholls, John M.
author_facet Lai, Jimmy Chun Cheong
Karunarathna, Herath M. T. K.
Wong, Ho Him
Peiris, Joseph S. M.
Nicholls, John M.
author_sort Lai, Jimmy Chun Cheong
collection PubMed
description Influenza virus haemagglutinin (HA) and neuraminidase (NA) are involved in the recognition and modulation of sialic acids on the cell surface as the virus receptor. Although the balance between two proteins functions has been found to be crucial for viral fitness, the interplay between the proteins has not been well established. Herein we present evidence for interplay between influenza HA and NA, which may affect the balance between two glycoprotein functions. NA enzymatic activities against sialoglycans were promoted by the presence of HA, which is in accordance with the level of co-existing HA. Such activity enhancement was lost when the HA-receptor binding properties were abolished by low-pH treatment or by mutations at the HA receptor binding domain. Sialidase activities of NA-containing virus-like particles and native influenza viruses were detected using different NA-assays and sialic acid substrates. Most pronounced HA-mediated NA enhancement was found when intact virions were confronted with multivalent surface-anchored substrates, which mimics the physiological conditions on cell membranes. Using recombinant viruses with altered HA bindings preference between α2,3- and α2,6-linked sialic acids, we also found that NA function against different substrates is correlated with the HA-receptor specificity. The effect of HA-receptor specificities on NA functions, together with the HA-mediated NA enhancement, may play a role in virus evasion of the mucus barrier, as well as in cross-species adaptation. Our data also indicate the importance of using multivalent substrates in future studies of NA functions.
format Online
Article
Text
id pubmed-6455212
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher Taylor & Francis
record_format MEDLINE/PubMed
spelling pubmed-64552122019-04-18 Neuraminidase activity and specificity of influenza A virus are influenced by haemagglutinin-receptor binding Lai, Jimmy Chun Cheong Karunarathna, Herath M. T. K. Wong, Ho Him Peiris, Joseph S. M. Nicholls, John M. Emerg Microbes Infect Article Influenza virus haemagglutinin (HA) and neuraminidase (NA) are involved in the recognition and modulation of sialic acids on the cell surface as the virus receptor. Although the balance between two proteins functions has been found to be crucial for viral fitness, the interplay between the proteins has not been well established. Herein we present evidence for interplay between influenza HA and NA, which may affect the balance between two glycoprotein functions. NA enzymatic activities against sialoglycans were promoted by the presence of HA, which is in accordance with the level of co-existing HA. Such activity enhancement was lost when the HA-receptor binding properties were abolished by low-pH treatment or by mutations at the HA receptor binding domain. Sialidase activities of NA-containing virus-like particles and native influenza viruses were detected using different NA-assays and sialic acid substrates. Most pronounced HA-mediated NA enhancement was found when intact virions were confronted with multivalent surface-anchored substrates, which mimics the physiological conditions on cell membranes. Using recombinant viruses with altered HA bindings preference between α2,3- and α2,6-linked sialic acids, we also found that NA function against different substrates is correlated with the HA-receptor specificity. The effect of HA-receptor specificities on NA functions, together with the HA-mediated NA enhancement, may play a role in virus evasion of the mucus barrier, as well as in cross-species adaptation. Our data also indicate the importance of using multivalent substrates in future studies of NA functions. Taylor & Francis 2019-02-27 /pmc/articles/PMC6455212/ /pubmed/30866786 http://dx.doi.org/10.1080/22221751.2019.1581034 Text en © 2019 The Author(s). Published by Informa UK Limited, trading as Taylor & Francis Group http://creativecommons.org/licenses/by/4.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Article
Lai, Jimmy Chun Cheong
Karunarathna, Herath M. T. K.
Wong, Ho Him
Peiris, Joseph S. M.
Nicholls, John M.
Neuraminidase activity and specificity of influenza A virus are influenced by haemagglutinin-receptor binding
title Neuraminidase activity and specificity of influenza A virus are influenced by haemagglutinin-receptor binding
title_full Neuraminidase activity and specificity of influenza A virus are influenced by haemagglutinin-receptor binding
title_fullStr Neuraminidase activity and specificity of influenza A virus are influenced by haemagglutinin-receptor binding
title_full_unstemmed Neuraminidase activity and specificity of influenza A virus are influenced by haemagglutinin-receptor binding
title_short Neuraminidase activity and specificity of influenza A virus are influenced by haemagglutinin-receptor binding
title_sort neuraminidase activity and specificity of influenza a virus are influenced by haemagglutinin-receptor binding
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6455212/
https://www.ncbi.nlm.nih.gov/pubmed/30866786
http://dx.doi.org/10.1080/22221751.2019.1581034
work_keys_str_mv AT laijimmychuncheong neuraminidaseactivityandspecificityofinfluenzaavirusareinfluencedbyhaemagglutininreceptorbinding
AT karunarathnaherathmtk neuraminidaseactivityandspecificityofinfluenzaavirusareinfluencedbyhaemagglutininreceptorbinding
AT wonghohim neuraminidaseactivityandspecificityofinfluenzaavirusareinfluencedbyhaemagglutininreceptorbinding
AT peirisjosephsm neuraminidaseactivityandspecificityofinfluenzaavirusareinfluencedbyhaemagglutininreceptorbinding
AT nichollsjohnm neuraminidaseactivityandspecificityofinfluenzaavirusareinfluencedbyhaemagglutininreceptorbinding