Cargando…
NEP-TC a rRNA Methyltransferase Involved on Somatic Embryogenesis of Tamarillo (Solanum betaceum Cav.)
Somatic embryogenesis (SE) is an important biotechnological tool for large-scale clonal propagation and for embryogenesis research. Moreover, genetic transformation and cryopreservation procedures in many species rely on efficient SE protocols. We have been studying different aspects related to SE i...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6459958/ https://www.ncbi.nlm.nih.gov/pubmed/31024602 http://dx.doi.org/10.3389/fpls.2019.00438 |
_version_ | 1783410261816770560 |
---|---|
author | Correia, Sandra Alhinho, Ana T. Casimiro, Bruno Miguel, Célia M. Oliveira, Margarida Veríssimo, Paula Canhoto, Jorge |
author_facet | Correia, Sandra Alhinho, Ana T. Casimiro, Bruno Miguel, Célia M. Oliveira, Margarida Veríssimo, Paula Canhoto, Jorge |
author_sort | Correia, Sandra |
collection | PubMed |
description | Somatic embryogenesis (SE) is an important biotechnological tool for large-scale clonal propagation and for embryogenesis research. Moreover, genetic transformation and cryopreservation procedures in many species rely on efficient SE protocols. We have been studying different aspects related to SE induction and somatic embryo development in tamarillo (Solanum betaceum Cav.), a small tree from the Solanaceae family. Previous proteomic analyses identified a protein (NEP-TC, 26.5 kDa) consistently present in non-embryogenic calluses of tamarillo, but absent in the embryogenic ones. In this work, the role of NEP-TC during SE was assessed by gene expression analysis and immunolocalization. The results obtained demonstrated that NEP-TC is a putative member of the SpoU rRNA methylase family. This protein, present in the cytoplasm and nucleus, is expressed in non-embryogenic cells and not expressed in embryogenic cells. Slightly enhanced SE induction levels in tamarillo plants with NEP-TC down-regulated levels also supports the role of this protein on SE induction. Heterologous expression was used to confirm NEP-TC rRNA methyltransferase activity, with enhanced activity levels when rRNA was used as a substrate. These data relate a putative member of the SpoU methylase family with plant morphogenesis, in particular with SE induction. |
format | Online Article Text |
id | pubmed-6459958 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-64599582019-04-25 NEP-TC a rRNA Methyltransferase Involved on Somatic Embryogenesis of Tamarillo (Solanum betaceum Cav.) Correia, Sandra Alhinho, Ana T. Casimiro, Bruno Miguel, Célia M. Oliveira, Margarida Veríssimo, Paula Canhoto, Jorge Front Plant Sci Plant Science Somatic embryogenesis (SE) is an important biotechnological tool for large-scale clonal propagation and for embryogenesis research. Moreover, genetic transformation and cryopreservation procedures in many species rely on efficient SE protocols. We have been studying different aspects related to SE induction and somatic embryo development in tamarillo (Solanum betaceum Cav.), a small tree from the Solanaceae family. Previous proteomic analyses identified a protein (NEP-TC, 26.5 kDa) consistently present in non-embryogenic calluses of tamarillo, but absent in the embryogenic ones. In this work, the role of NEP-TC during SE was assessed by gene expression analysis and immunolocalization. The results obtained demonstrated that NEP-TC is a putative member of the SpoU rRNA methylase family. This protein, present in the cytoplasm and nucleus, is expressed in non-embryogenic cells and not expressed in embryogenic cells. Slightly enhanced SE induction levels in tamarillo plants with NEP-TC down-regulated levels also supports the role of this protein on SE induction. Heterologous expression was used to confirm NEP-TC rRNA methyltransferase activity, with enhanced activity levels when rRNA was used as a substrate. These data relate a putative member of the SpoU methylase family with plant morphogenesis, in particular with SE induction. Frontiers Media S.A. 2019-04-05 /pmc/articles/PMC6459958/ /pubmed/31024602 http://dx.doi.org/10.3389/fpls.2019.00438 Text en Copyright © 2019 Correia, Alhinho, Casimiro, Miguel, Oliveira, Veríssimo and Canhoto. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Plant Science Correia, Sandra Alhinho, Ana T. Casimiro, Bruno Miguel, Célia M. Oliveira, Margarida Veríssimo, Paula Canhoto, Jorge NEP-TC a rRNA Methyltransferase Involved on Somatic Embryogenesis of Tamarillo (Solanum betaceum Cav.) |
title | NEP-TC a rRNA Methyltransferase Involved on Somatic Embryogenesis of Tamarillo (Solanum betaceum Cav.) |
title_full | NEP-TC a rRNA Methyltransferase Involved on Somatic Embryogenesis of Tamarillo (Solanum betaceum Cav.) |
title_fullStr | NEP-TC a rRNA Methyltransferase Involved on Somatic Embryogenesis of Tamarillo (Solanum betaceum Cav.) |
title_full_unstemmed | NEP-TC a rRNA Methyltransferase Involved on Somatic Embryogenesis of Tamarillo (Solanum betaceum Cav.) |
title_short | NEP-TC a rRNA Methyltransferase Involved on Somatic Embryogenesis of Tamarillo (Solanum betaceum Cav.) |
title_sort | nep-tc a rrna methyltransferase involved on somatic embryogenesis of tamarillo (solanum betaceum cav.) |
topic | Plant Science |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6459958/ https://www.ncbi.nlm.nih.gov/pubmed/31024602 http://dx.doi.org/10.3389/fpls.2019.00438 |
work_keys_str_mv | AT correiasandra neptcarrnamethyltransferaseinvolvedonsomaticembryogenesisoftamarillosolanumbetaceumcav AT alhinhoanat neptcarrnamethyltransferaseinvolvedonsomaticembryogenesisoftamarillosolanumbetaceumcav AT casimirobruno neptcarrnamethyltransferaseinvolvedonsomaticembryogenesisoftamarillosolanumbetaceumcav AT miguelceliam neptcarrnamethyltransferaseinvolvedonsomaticembryogenesisoftamarillosolanumbetaceumcav AT oliveiramargarida neptcarrnamethyltransferaseinvolvedonsomaticembryogenesisoftamarillosolanumbetaceumcav AT verissimopaula neptcarrnamethyltransferaseinvolvedonsomaticembryogenesisoftamarillosolanumbetaceumcav AT canhotojorge neptcarrnamethyltransferaseinvolvedonsomaticembryogenesisoftamarillosolanumbetaceumcav |