Cargando…
Loss-of-Function of a Tomato Receptor-Like Kinase Impairs Male Fertility and Induces Parthenocarpic Fruit Set
Parthenocarpy arises when an ovary develops into fruit without pollination/fertilization. The mechanisms involved in genetic parthenocarpy have attracted attention because of their potential application in plant breeding and also for their elucidation of the mechanisms involved in early fruit develo...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Frontiers Media S.A.
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6477066/ https://www.ncbi.nlm.nih.gov/pubmed/31040856 http://dx.doi.org/10.3389/fpls.2019.00403 |
_version_ | 1783412992602275840 |
---|---|
author | Takei, Hitomi Shinozaki, Yoshihito Yano, Ryoichi Kashojiya, Sachiko Hernould, Michel Chevalier, Christian Ezura, Hiroshi Ariizumi, Tohru |
author_facet | Takei, Hitomi Shinozaki, Yoshihito Yano, Ryoichi Kashojiya, Sachiko Hernould, Michel Chevalier, Christian Ezura, Hiroshi Ariizumi, Tohru |
author_sort | Takei, Hitomi |
collection | PubMed |
description | Parthenocarpy arises when an ovary develops into fruit without pollination/fertilization. The mechanisms involved in genetic parthenocarpy have attracted attention because of their potential application in plant breeding and also for their elucidation of the mechanisms involved in early fruit development. We have isolated and characterized a novel small parthenocarpic fruit and flower (spff) mutant in the tomato (Solanum lycopersicum) cultivar Micro-Tom. This plant showed both vegetative and reproductive phenotypes including dwarfism of floral organs, male sterility, delayed flowering, altered axillary shoot development, and parthenocarpic production of small fruits. Genome-wide single nucleotide polymorphism array analysis coupled with mapping-by-sequencing using next generation sequencing-based high-throughput approaches resulted in the identification of a candidate locus responsible for the spff mutant phenotype. Subsequent linkage analysis and RNA interference-based silencing indicated that these phenotypes were caused by a loss-of-function mutation of a single gene (Solyc04g077010), which encodes a receptor-like protein kinase that was expressed in vascular bundles in young buds. Cytological and transcriptomic analyses suggested that parthenocarpy in the spff mutant was associated with enlarged ovarian cells and with elevated expression of the gibberellin metabolism gene, GA20ox1. Taken together, our results suggest a role for Solyc04g077010 in male organ development and indicate that loss of this receptor-like protein kinase activity could result in parthenocarpy. |
format | Online Article Text |
id | pubmed-6477066 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | Frontiers Media S.A. |
record_format | MEDLINE/PubMed |
spelling | pubmed-64770662019-04-30 Loss-of-Function of a Tomato Receptor-Like Kinase Impairs Male Fertility and Induces Parthenocarpic Fruit Set Takei, Hitomi Shinozaki, Yoshihito Yano, Ryoichi Kashojiya, Sachiko Hernould, Michel Chevalier, Christian Ezura, Hiroshi Ariizumi, Tohru Front Plant Sci Plant Science Parthenocarpy arises when an ovary develops into fruit without pollination/fertilization. The mechanisms involved in genetic parthenocarpy have attracted attention because of their potential application in plant breeding and also for their elucidation of the mechanisms involved in early fruit development. We have isolated and characterized a novel small parthenocarpic fruit and flower (spff) mutant in the tomato (Solanum lycopersicum) cultivar Micro-Tom. This plant showed both vegetative and reproductive phenotypes including dwarfism of floral organs, male sterility, delayed flowering, altered axillary shoot development, and parthenocarpic production of small fruits. Genome-wide single nucleotide polymorphism array analysis coupled with mapping-by-sequencing using next generation sequencing-based high-throughput approaches resulted in the identification of a candidate locus responsible for the spff mutant phenotype. Subsequent linkage analysis and RNA interference-based silencing indicated that these phenotypes were caused by a loss-of-function mutation of a single gene (Solyc04g077010), which encodes a receptor-like protein kinase that was expressed in vascular bundles in young buds. Cytological and transcriptomic analyses suggested that parthenocarpy in the spff mutant was associated with enlarged ovarian cells and with elevated expression of the gibberellin metabolism gene, GA20ox1. Taken together, our results suggest a role for Solyc04g077010 in male organ development and indicate that loss of this receptor-like protein kinase activity could result in parthenocarpy. Frontiers Media S.A. 2019-04-16 /pmc/articles/PMC6477066/ /pubmed/31040856 http://dx.doi.org/10.3389/fpls.2019.00403 Text en Copyright © 2019 Takei, Shinozaki, Yano, Kashojiya, Hernould, Chevalier, Ezura and Ariizumi. http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms. |
spellingShingle | Plant Science Takei, Hitomi Shinozaki, Yoshihito Yano, Ryoichi Kashojiya, Sachiko Hernould, Michel Chevalier, Christian Ezura, Hiroshi Ariizumi, Tohru Loss-of-Function of a Tomato Receptor-Like Kinase Impairs Male Fertility and Induces Parthenocarpic Fruit Set |
title | Loss-of-Function of a Tomato Receptor-Like Kinase Impairs Male Fertility and Induces Parthenocarpic Fruit Set |
title_full | Loss-of-Function of a Tomato Receptor-Like Kinase Impairs Male Fertility and Induces Parthenocarpic Fruit Set |
title_fullStr | Loss-of-Function of a Tomato Receptor-Like Kinase Impairs Male Fertility and Induces Parthenocarpic Fruit Set |
title_full_unstemmed | Loss-of-Function of a Tomato Receptor-Like Kinase Impairs Male Fertility and Induces Parthenocarpic Fruit Set |
title_short | Loss-of-Function of a Tomato Receptor-Like Kinase Impairs Male Fertility and Induces Parthenocarpic Fruit Set |
title_sort | loss-of-function of a tomato receptor-like kinase impairs male fertility and induces parthenocarpic fruit set |
topic | Plant Science |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6477066/ https://www.ncbi.nlm.nih.gov/pubmed/31040856 http://dx.doi.org/10.3389/fpls.2019.00403 |
work_keys_str_mv | AT takeihitomi lossoffunctionofatomatoreceptorlikekinaseimpairsmalefertilityandinducesparthenocarpicfruitset AT shinozakiyoshihito lossoffunctionofatomatoreceptorlikekinaseimpairsmalefertilityandinducesparthenocarpicfruitset AT yanoryoichi lossoffunctionofatomatoreceptorlikekinaseimpairsmalefertilityandinducesparthenocarpicfruitset AT kashojiyasachiko lossoffunctionofatomatoreceptorlikekinaseimpairsmalefertilityandinducesparthenocarpicfruitset AT hernouldmichel lossoffunctionofatomatoreceptorlikekinaseimpairsmalefertilityandinducesparthenocarpicfruitset AT chevalierchristian lossoffunctionofatomatoreceptorlikekinaseimpairsmalefertilityandinducesparthenocarpicfruitset AT ezurahiroshi lossoffunctionofatomatoreceptorlikekinaseimpairsmalefertilityandinducesparthenocarpicfruitset AT ariizumitohru lossoffunctionofatomatoreceptorlikekinaseimpairsmalefertilityandinducesparthenocarpicfruitset |