Cargando…

Clinical-histopathological and molecular study of ovine pulmonary adenocarcinoma in Awassi sheep in Al-Qadisiyah Province, Iraq

AIM: This study aimed to conduct a clinical-histopathological and molecular evaluation of ovine pulmonary adenocarcinoma (OPA) in Awassi sheep in various regions of Al-Qadisiyah Province, Iraq. MATERIALS AND METHODS: A total of 150 sheep were clinically evaluated, and the wheelbarrow test was perfor...

Descripción completa

Detalles Bibliográficos
Autores principales: Mansour, Khalefa Ali, Al-Husseiny, Saad Hashim, Kshash, Qassim Haleem, Jassim, Asaad
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Veterinary World 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6487251/
https://www.ncbi.nlm.nih.gov/pubmed/31089317
http://dx.doi.org/10.14202/vetworld.2019.454-458
_version_ 1783414465052540928
author Mansour, Khalefa Ali
Al-Husseiny, Saad Hashim
Kshash, Qassim Haleem
Jassim, Asaad
author_facet Mansour, Khalefa Ali
Al-Husseiny, Saad Hashim
Kshash, Qassim Haleem
Jassim, Asaad
author_sort Mansour, Khalefa Ali
collection PubMed
description AIM: This study aimed to conduct a clinical-histopathological and molecular evaluation of ovine pulmonary adenocarcinoma (OPA) in Awassi sheep in various regions of Al-Qadisiyah Province, Iraq. MATERIALS AND METHODS: A total of 150 sheep were clinically evaluated, and the wheelbarrow test was performed. 100 samples (35 blood, 25 lung tissue, 20 lymph node, and 20 lung fluid samples) were randomly selected from living and slaughtered sheep. All samples were subjected to polymerase chain reaction (PCR). Histopathological examinations were performed for four lung tissue and two lymph node samples. RESULTS: A diagnosis of OPA was made based on the results of the clinical examination and the clinical signs shown by the animals, such as dyspnea, polypnea, coughing, mucous nasal discharge, moist rales on auscultation of the affected lungs, and emaciation. Interestingly, the animals tested positive for the wheelbarrow test, with frothy nares accompanied by profuse and clear lung fluid. Histopathological examination showed various lesions such as glandular transformation in the lung tissues and emphysema. Moreover, lymph nodes showed marked follicular atrophy and necrosis-associated lymphocyte infiltration in the affected tissues. PCR revealed that 25% of the samples including eight (22.8%) blood, five (20%) lung tissue, five (25%) lymph node, and seven (35%) lung fluid samples were positive for Jaagsiekte sheep retrovirus; this result was highly significant. CONCLUSION: The results of our study indicated that in Iraq, OPA diagnosis should be based on pathological findings and results of advanced procedures such as PCR.
format Online
Article
Text
id pubmed-6487251
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher Veterinary World
record_format MEDLINE/PubMed
spelling pubmed-64872512019-05-14 Clinical-histopathological and molecular study of ovine pulmonary adenocarcinoma in Awassi sheep in Al-Qadisiyah Province, Iraq Mansour, Khalefa Ali Al-Husseiny, Saad Hashim Kshash, Qassim Haleem Jassim, Asaad Vet World Research Article AIM: This study aimed to conduct a clinical-histopathological and molecular evaluation of ovine pulmonary adenocarcinoma (OPA) in Awassi sheep in various regions of Al-Qadisiyah Province, Iraq. MATERIALS AND METHODS: A total of 150 sheep were clinically evaluated, and the wheelbarrow test was performed. 100 samples (35 blood, 25 lung tissue, 20 lymph node, and 20 lung fluid samples) were randomly selected from living and slaughtered sheep. All samples were subjected to polymerase chain reaction (PCR). Histopathological examinations were performed for four lung tissue and two lymph node samples. RESULTS: A diagnosis of OPA was made based on the results of the clinical examination and the clinical signs shown by the animals, such as dyspnea, polypnea, coughing, mucous nasal discharge, moist rales on auscultation of the affected lungs, and emaciation. Interestingly, the animals tested positive for the wheelbarrow test, with frothy nares accompanied by profuse and clear lung fluid. Histopathological examination showed various lesions such as glandular transformation in the lung tissues and emphysema. Moreover, lymph nodes showed marked follicular atrophy and necrosis-associated lymphocyte infiltration in the affected tissues. PCR revealed that 25% of the samples including eight (22.8%) blood, five (20%) lung tissue, five (25%) lymph node, and seven (35%) lung fluid samples were positive for Jaagsiekte sheep retrovirus; this result was highly significant. CONCLUSION: The results of our study indicated that in Iraq, OPA diagnosis should be based on pathological findings and results of advanced procedures such as PCR. Veterinary World 2019 2019-03-26 /pmc/articles/PMC6487251/ /pubmed/31089317 http://dx.doi.org/10.14202/vetworld.2019.454-458 Text en Copyright: © Mansour, et al. http://creativecommons.org/licenses/by/4.0 Open Access. This article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Mansour, Khalefa Ali
Al-Husseiny, Saad Hashim
Kshash, Qassim Haleem
Jassim, Asaad
Clinical-histopathological and molecular study of ovine pulmonary adenocarcinoma in Awassi sheep in Al-Qadisiyah Province, Iraq
title Clinical-histopathological and molecular study of ovine pulmonary adenocarcinoma in Awassi sheep in Al-Qadisiyah Province, Iraq
title_full Clinical-histopathological and molecular study of ovine pulmonary adenocarcinoma in Awassi sheep in Al-Qadisiyah Province, Iraq
title_fullStr Clinical-histopathological and molecular study of ovine pulmonary adenocarcinoma in Awassi sheep in Al-Qadisiyah Province, Iraq
title_full_unstemmed Clinical-histopathological and molecular study of ovine pulmonary adenocarcinoma in Awassi sheep in Al-Qadisiyah Province, Iraq
title_short Clinical-histopathological and molecular study of ovine pulmonary adenocarcinoma in Awassi sheep in Al-Qadisiyah Province, Iraq
title_sort clinical-histopathological and molecular study of ovine pulmonary adenocarcinoma in awassi sheep in al-qadisiyah province, iraq
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6487251/
https://www.ncbi.nlm.nih.gov/pubmed/31089317
http://dx.doi.org/10.14202/vetworld.2019.454-458
work_keys_str_mv AT mansourkhalefaali clinicalhistopathologicalandmolecularstudyofovinepulmonaryadenocarcinomainawassisheepinalqadisiyahprovinceiraq
AT alhusseinysaadhashim clinicalhistopathologicalandmolecularstudyofovinepulmonaryadenocarcinomainawassisheepinalqadisiyahprovinceiraq
AT kshashqassimhaleem clinicalhistopathologicalandmolecularstudyofovinepulmonaryadenocarcinomainawassisheepinalqadisiyahprovinceiraq
AT jassimasaad clinicalhistopathologicalandmolecularstudyofovinepulmonaryadenocarcinomainawassisheepinalqadisiyahprovinceiraq