Cargando…
Clinical-histopathological and molecular study of ovine pulmonary adenocarcinoma in Awassi sheep in Al-Qadisiyah Province, Iraq
AIM: This study aimed to conduct a clinical-histopathological and molecular evaluation of ovine pulmonary adenocarcinoma (OPA) in Awassi sheep in various regions of Al-Qadisiyah Province, Iraq. MATERIALS AND METHODS: A total of 150 sheep were clinically evaluated, and the wheelbarrow test was perfor...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Veterinary World
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6487251/ https://www.ncbi.nlm.nih.gov/pubmed/31089317 http://dx.doi.org/10.14202/vetworld.2019.454-458 |
_version_ | 1783414465052540928 |
---|---|
author | Mansour, Khalefa Ali Al-Husseiny, Saad Hashim Kshash, Qassim Haleem Jassim, Asaad |
author_facet | Mansour, Khalefa Ali Al-Husseiny, Saad Hashim Kshash, Qassim Haleem Jassim, Asaad |
author_sort | Mansour, Khalefa Ali |
collection | PubMed |
description | AIM: This study aimed to conduct a clinical-histopathological and molecular evaluation of ovine pulmonary adenocarcinoma (OPA) in Awassi sheep in various regions of Al-Qadisiyah Province, Iraq. MATERIALS AND METHODS: A total of 150 sheep were clinically evaluated, and the wheelbarrow test was performed. 100 samples (35 blood, 25 lung tissue, 20 lymph node, and 20 lung fluid samples) were randomly selected from living and slaughtered sheep. All samples were subjected to polymerase chain reaction (PCR). Histopathological examinations were performed for four lung tissue and two lymph node samples. RESULTS: A diagnosis of OPA was made based on the results of the clinical examination and the clinical signs shown by the animals, such as dyspnea, polypnea, coughing, mucous nasal discharge, moist rales on auscultation of the affected lungs, and emaciation. Interestingly, the animals tested positive for the wheelbarrow test, with frothy nares accompanied by profuse and clear lung fluid. Histopathological examination showed various lesions such as glandular transformation in the lung tissues and emphysema. Moreover, lymph nodes showed marked follicular atrophy and necrosis-associated lymphocyte infiltration in the affected tissues. PCR revealed that 25% of the samples including eight (22.8%) blood, five (20%) lung tissue, five (25%) lymph node, and seven (35%) lung fluid samples were positive for Jaagsiekte sheep retrovirus; this result was highly significant. CONCLUSION: The results of our study indicated that in Iraq, OPA diagnosis should be based on pathological findings and results of advanced procedures such as PCR. |
format | Online Article Text |
id | pubmed-6487251 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | Veterinary World |
record_format | MEDLINE/PubMed |
spelling | pubmed-64872512019-05-14 Clinical-histopathological and molecular study of ovine pulmonary adenocarcinoma in Awassi sheep in Al-Qadisiyah Province, Iraq Mansour, Khalefa Ali Al-Husseiny, Saad Hashim Kshash, Qassim Haleem Jassim, Asaad Vet World Research Article AIM: This study aimed to conduct a clinical-histopathological and molecular evaluation of ovine pulmonary adenocarcinoma (OPA) in Awassi sheep in various regions of Al-Qadisiyah Province, Iraq. MATERIALS AND METHODS: A total of 150 sheep were clinically evaluated, and the wheelbarrow test was performed. 100 samples (35 blood, 25 lung tissue, 20 lymph node, and 20 lung fluid samples) were randomly selected from living and slaughtered sheep. All samples were subjected to polymerase chain reaction (PCR). Histopathological examinations were performed for four lung tissue and two lymph node samples. RESULTS: A diagnosis of OPA was made based on the results of the clinical examination and the clinical signs shown by the animals, such as dyspnea, polypnea, coughing, mucous nasal discharge, moist rales on auscultation of the affected lungs, and emaciation. Interestingly, the animals tested positive for the wheelbarrow test, with frothy nares accompanied by profuse and clear lung fluid. Histopathological examination showed various lesions such as glandular transformation in the lung tissues and emphysema. Moreover, lymph nodes showed marked follicular atrophy and necrosis-associated lymphocyte infiltration in the affected tissues. PCR revealed that 25% of the samples including eight (22.8%) blood, five (20%) lung tissue, five (25%) lymph node, and seven (35%) lung fluid samples were positive for Jaagsiekte sheep retrovirus; this result was highly significant. CONCLUSION: The results of our study indicated that in Iraq, OPA diagnosis should be based on pathological findings and results of advanced procedures such as PCR. Veterinary World 2019 2019-03-26 /pmc/articles/PMC6487251/ /pubmed/31089317 http://dx.doi.org/10.14202/vetworld.2019.454-458 Text en Copyright: © Mansour, et al. http://creativecommons.org/licenses/by/4.0 Open Access. This article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Mansour, Khalefa Ali Al-Husseiny, Saad Hashim Kshash, Qassim Haleem Jassim, Asaad Clinical-histopathological and molecular study of ovine pulmonary adenocarcinoma in Awassi sheep in Al-Qadisiyah Province, Iraq |
title | Clinical-histopathological and molecular study of ovine pulmonary adenocarcinoma in Awassi sheep in Al-Qadisiyah Province, Iraq |
title_full | Clinical-histopathological and molecular study of ovine pulmonary adenocarcinoma in Awassi sheep in Al-Qadisiyah Province, Iraq |
title_fullStr | Clinical-histopathological and molecular study of ovine pulmonary adenocarcinoma in Awassi sheep in Al-Qadisiyah Province, Iraq |
title_full_unstemmed | Clinical-histopathological and molecular study of ovine pulmonary adenocarcinoma in Awassi sheep in Al-Qadisiyah Province, Iraq |
title_short | Clinical-histopathological and molecular study of ovine pulmonary adenocarcinoma in Awassi sheep in Al-Qadisiyah Province, Iraq |
title_sort | clinical-histopathological and molecular study of ovine pulmonary adenocarcinoma in awassi sheep in al-qadisiyah province, iraq |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6487251/ https://www.ncbi.nlm.nih.gov/pubmed/31089317 http://dx.doi.org/10.14202/vetworld.2019.454-458 |
work_keys_str_mv | AT mansourkhalefaali clinicalhistopathologicalandmolecularstudyofovinepulmonaryadenocarcinomainawassisheepinalqadisiyahprovinceiraq AT alhusseinysaadhashim clinicalhistopathologicalandmolecularstudyofovinepulmonaryadenocarcinomainawassisheepinalqadisiyahprovinceiraq AT kshashqassimhaleem clinicalhistopathologicalandmolecularstudyofovinepulmonaryadenocarcinomainawassisheepinalqadisiyahprovinceiraq AT jassimasaad clinicalhistopathologicalandmolecularstudyofovinepulmonaryadenocarcinomainawassisheepinalqadisiyahprovinceiraq |