Cargando…
NR5A1 gene variants repress the ovarian‐specific WNT signaling pathway in 46,XX disorders of sex development patients
Several recent reports have described a missense variant in the gene NR5A1 (c.274C>T; p.Arg92Trp) in a significant number of 46,XX ovotesticular or testicular disorders of sex development (DSDs) cases. The affected residue falls within the DNA‐binding domain of the NR5A1 protein, however the exac...
Autores principales: | , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
John Wiley and Sons Inc.
2018
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6492147/ https://www.ncbi.nlm.nih.gov/pubmed/30350900 http://dx.doi.org/10.1002/humu.23672 |
_version_ | 1783415091682607104 |
---|---|
author | Knarston, Ingrid M. Robevska, Gorjana van den Bergen, Jocelyn A Eggers, Stefanie Croft, Brittany Yates, Jason Hersmus, Remko Looijenga, Leendert H. J. Cameron, Fergus J. Monhike, Klaus Ayers, Katie L. Sinclair, Andrew H. |
author_facet | Knarston, Ingrid M. Robevska, Gorjana van den Bergen, Jocelyn A Eggers, Stefanie Croft, Brittany Yates, Jason Hersmus, Remko Looijenga, Leendert H. J. Cameron, Fergus J. Monhike, Klaus Ayers, Katie L. Sinclair, Andrew H. |
author_sort | Knarston, Ingrid M. |
collection | PubMed |
description | Several recent reports have described a missense variant in the gene NR5A1 (c.274C>T; p.Arg92Trp) in a significant number of 46,XX ovotesticular or testicular disorders of sex development (DSDs) cases. The affected residue falls within the DNA‐binding domain of the NR5A1 protein, however the exact mechanism by which it causes testicular development in 46,XX individuals remains unclear. We have screened a cohort of 26 patients with 46,XX (ovo)testicular DSD and identified three unrelated individuals with this NR5A1 variant (p.Arg92Trp), as well as one patient with a novel NR5A1 variant (c.779C>T; p.Ala260Val). We examined the functional effect of these changes, finding that while protein levels and localization were unaffected, variant NR5A1 proteins repress the WNT signaling pathway and have less ability to upregulate the anti‐testis gene NR0B1. These findings highlight how NR5A1 variants impact ovarian differentiation across multiple pathways, resulting in a switch from ovarian to testis development in genetic females. |
format | Online Article Text |
id | pubmed-6492147 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2018 |
publisher | John Wiley and Sons Inc. |
record_format | MEDLINE/PubMed |
spelling | pubmed-64921472019-05-06 NR5A1 gene variants repress the ovarian‐specific WNT signaling pathway in 46,XX disorders of sex development patients Knarston, Ingrid M. Robevska, Gorjana van den Bergen, Jocelyn A Eggers, Stefanie Croft, Brittany Yates, Jason Hersmus, Remko Looijenga, Leendert H. J. Cameron, Fergus J. Monhike, Klaus Ayers, Katie L. Sinclair, Andrew H. Hum Mutat Research Articles Several recent reports have described a missense variant in the gene NR5A1 (c.274C>T; p.Arg92Trp) in a significant number of 46,XX ovotesticular or testicular disorders of sex development (DSDs) cases. The affected residue falls within the DNA‐binding domain of the NR5A1 protein, however the exact mechanism by which it causes testicular development in 46,XX individuals remains unclear. We have screened a cohort of 26 patients with 46,XX (ovo)testicular DSD and identified three unrelated individuals with this NR5A1 variant (p.Arg92Trp), as well as one patient with a novel NR5A1 variant (c.779C>T; p.Ala260Val). We examined the functional effect of these changes, finding that while protein levels and localization were unaffected, variant NR5A1 proteins repress the WNT signaling pathway and have less ability to upregulate the anti‐testis gene NR0B1. These findings highlight how NR5A1 variants impact ovarian differentiation across multiple pathways, resulting in a switch from ovarian to testis development in genetic females. John Wiley and Sons Inc. 2018-11-30 2019-02 /pmc/articles/PMC6492147/ /pubmed/30350900 http://dx.doi.org/10.1002/humu.23672 Text en © 2018 The Authors. Human Mutation published by Wiley Periodicals, Inc. This is an open access article under the terms of the http://creativecommons.org/licenses/by/4.0/ License, which permits use, distribution and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Articles Knarston, Ingrid M. Robevska, Gorjana van den Bergen, Jocelyn A Eggers, Stefanie Croft, Brittany Yates, Jason Hersmus, Remko Looijenga, Leendert H. J. Cameron, Fergus J. Monhike, Klaus Ayers, Katie L. Sinclair, Andrew H. NR5A1 gene variants repress the ovarian‐specific WNT signaling pathway in 46,XX disorders of sex development patients |
title |
NR5A1 gene variants repress the ovarian‐specific WNT signaling pathway in 46,XX disorders of sex development patients |
title_full |
NR5A1 gene variants repress the ovarian‐specific WNT signaling pathway in 46,XX disorders of sex development patients |
title_fullStr |
NR5A1 gene variants repress the ovarian‐specific WNT signaling pathway in 46,XX disorders of sex development patients |
title_full_unstemmed |
NR5A1 gene variants repress the ovarian‐specific WNT signaling pathway in 46,XX disorders of sex development patients |
title_short |
NR5A1 gene variants repress the ovarian‐specific WNT signaling pathway in 46,XX disorders of sex development patients |
title_sort | nr5a1 gene variants repress the ovarian‐specific wnt signaling pathway in 46,xx disorders of sex development patients |
topic | Research Articles |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6492147/ https://www.ncbi.nlm.nih.gov/pubmed/30350900 http://dx.doi.org/10.1002/humu.23672 |
work_keys_str_mv | AT knarstoningridm nr5a1genevariantsrepresstheovarianspecificwntsignalingpathwayin46xxdisordersofsexdevelopmentpatients AT robevskagorjana nr5a1genevariantsrepresstheovarianspecificwntsignalingpathwayin46xxdisordersofsexdevelopmentpatients AT vandenbergenjocelyna nr5a1genevariantsrepresstheovarianspecificwntsignalingpathwayin46xxdisordersofsexdevelopmentpatients AT eggersstefanie nr5a1genevariantsrepresstheovarianspecificwntsignalingpathwayin46xxdisordersofsexdevelopmentpatients AT croftbrittany nr5a1genevariantsrepresstheovarianspecificwntsignalingpathwayin46xxdisordersofsexdevelopmentpatients AT yatesjason nr5a1genevariantsrepresstheovarianspecificwntsignalingpathwayin46xxdisordersofsexdevelopmentpatients AT hersmusremko nr5a1genevariantsrepresstheovarianspecificwntsignalingpathwayin46xxdisordersofsexdevelopmentpatients AT looijengaleenderthj nr5a1genevariantsrepresstheovarianspecificwntsignalingpathwayin46xxdisordersofsexdevelopmentpatients AT cameronfergusj nr5a1genevariantsrepresstheovarianspecificwntsignalingpathwayin46xxdisordersofsexdevelopmentpatients AT monhikeklaus nr5a1genevariantsrepresstheovarianspecificwntsignalingpathwayin46xxdisordersofsexdevelopmentpatients AT ayerskatiel nr5a1genevariantsrepresstheovarianspecificwntsignalingpathwayin46xxdisordersofsexdevelopmentpatients AT sinclairandrewh nr5a1genevariantsrepresstheovarianspecificwntsignalingpathwayin46xxdisordersofsexdevelopmentpatients |