Cargando…
R406 elicits anti-Warburg effect via Syk-dependent and -independent mechanisms to trigger apoptosis in glioma stem cells
Given that glioma stem cells (GSCs) play a critical role in the initiation and chemoresistance in glioblastoma multiforme (GBM), targeting GSCs is an attractive strategy to treat GBM. Utilizing an anti-cancer compound library, we identified R406, the active metabolite of a FDA-approved Syk inhibitor...
Autores principales: | , , , , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Nature Publishing Group UK
2019
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6494878/ https://www.ncbi.nlm.nih.gov/pubmed/31043589 http://dx.doi.org/10.1038/s41419-019-1587-0 |
_version_ | 1783415291821162496 |
---|---|
author | Sun, Shuxin Xue, Dongdong Chen, Zhijie Ou-yang, Ying Zhang, Ji Mai, Jialuo Gu, Jiayv Lu, Wanjun Liu, Xincheng Liu, Wenfeng Sheng, Longxiang Lu, Bingzheng Lin, Yuan Xing, Fan Chen, Zhongping Mou, Yonggao Yan, Guangmei Zhu, Wenbo Sai, Ke |
author_facet | Sun, Shuxin Xue, Dongdong Chen, Zhijie Ou-yang, Ying Zhang, Ji Mai, Jialuo Gu, Jiayv Lu, Wanjun Liu, Xincheng Liu, Wenfeng Sheng, Longxiang Lu, Bingzheng Lin, Yuan Xing, Fan Chen, Zhongping Mou, Yonggao Yan, Guangmei Zhu, Wenbo Sai, Ke |
author_sort | Sun, Shuxin |
collection | PubMed |
description | Given that glioma stem cells (GSCs) play a critical role in the initiation and chemoresistance in glioblastoma multiforme (GBM), targeting GSCs is an attractive strategy to treat GBM. Utilizing an anti-cancer compound library, we identified R406, the active metabolite of a FDA-approved Syk inhibitor for immune thrombocytopenia (ITP), with remarkable cytotoxicity against GSCs but not normal neural stem cells. R406 significantly inhibited neurosphere formation and triggered apoptosis in GSCs. R406 induced a metabolic shift from glycolysis to oxidative phosphorylation (OXPHOS) and subsequently production of excess ROS in GSCs. R406 also diminished tumor growth and efficiently sensitized gliomas to temozolomide in GSC-initiating xenograft mouse models. Mechanistically, the anti-GSC effect of R406 was due to the disruption of Syk/PI3K signaling in Syk-positive GSCs and PI3K/Akt pathway in Syk-negative GSCs respectively. Overall, these findings not only identify R406 as a promising GSC-targeting agent but also reveal the important role of Syk and PI3K pathways in the regulation of energy metabolism in GSCs. |
format | Online Article Text |
id | pubmed-6494878 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2019 |
publisher | Nature Publishing Group UK |
record_format | MEDLINE/PubMed |
spelling | pubmed-64948782019-05-02 R406 elicits anti-Warburg effect via Syk-dependent and -independent mechanisms to trigger apoptosis in glioma stem cells Sun, Shuxin Xue, Dongdong Chen, Zhijie Ou-yang, Ying Zhang, Ji Mai, Jialuo Gu, Jiayv Lu, Wanjun Liu, Xincheng Liu, Wenfeng Sheng, Longxiang Lu, Bingzheng Lin, Yuan Xing, Fan Chen, Zhongping Mou, Yonggao Yan, Guangmei Zhu, Wenbo Sai, Ke Cell Death Dis Article Given that glioma stem cells (GSCs) play a critical role in the initiation and chemoresistance in glioblastoma multiforme (GBM), targeting GSCs is an attractive strategy to treat GBM. Utilizing an anti-cancer compound library, we identified R406, the active metabolite of a FDA-approved Syk inhibitor for immune thrombocytopenia (ITP), with remarkable cytotoxicity against GSCs but not normal neural stem cells. R406 significantly inhibited neurosphere formation and triggered apoptosis in GSCs. R406 induced a metabolic shift from glycolysis to oxidative phosphorylation (OXPHOS) and subsequently production of excess ROS in GSCs. R406 also diminished tumor growth and efficiently sensitized gliomas to temozolomide in GSC-initiating xenograft mouse models. Mechanistically, the anti-GSC effect of R406 was due to the disruption of Syk/PI3K signaling in Syk-positive GSCs and PI3K/Akt pathway in Syk-negative GSCs respectively. Overall, these findings not only identify R406 as a promising GSC-targeting agent but also reveal the important role of Syk and PI3K pathways in the regulation of energy metabolism in GSCs. Nature Publishing Group UK 2019-05-01 /pmc/articles/PMC6494878/ /pubmed/31043589 http://dx.doi.org/10.1038/s41419-019-1587-0 Text en © The Author(s) 2019 Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons license, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons license and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this license, visit http://creativecommons.org/licenses/by/4.0/. |
spellingShingle | Article Sun, Shuxin Xue, Dongdong Chen, Zhijie Ou-yang, Ying Zhang, Ji Mai, Jialuo Gu, Jiayv Lu, Wanjun Liu, Xincheng Liu, Wenfeng Sheng, Longxiang Lu, Bingzheng Lin, Yuan Xing, Fan Chen, Zhongping Mou, Yonggao Yan, Guangmei Zhu, Wenbo Sai, Ke R406 elicits anti-Warburg effect via Syk-dependent and -independent mechanisms to trigger apoptosis in glioma stem cells |
title | R406 elicits anti-Warburg effect via Syk-dependent and -independent mechanisms to trigger apoptosis in glioma stem cells |
title_full | R406 elicits anti-Warburg effect via Syk-dependent and -independent mechanisms to trigger apoptosis in glioma stem cells |
title_fullStr | R406 elicits anti-Warburg effect via Syk-dependent and -independent mechanisms to trigger apoptosis in glioma stem cells |
title_full_unstemmed | R406 elicits anti-Warburg effect via Syk-dependent and -independent mechanisms to trigger apoptosis in glioma stem cells |
title_short | R406 elicits anti-Warburg effect via Syk-dependent and -independent mechanisms to trigger apoptosis in glioma stem cells |
title_sort | r406 elicits anti-warburg effect via syk-dependent and -independent mechanisms to trigger apoptosis in glioma stem cells |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6494878/ https://www.ncbi.nlm.nih.gov/pubmed/31043589 http://dx.doi.org/10.1038/s41419-019-1587-0 |
work_keys_str_mv | AT sunshuxin r406elicitsantiwarburgeffectviasykdependentandindependentmechanismstotriggerapoptosisingliomastemcells AT xuedongdong r406elicitsantiwarburgeffectviasykdependentandindependentmechanismstotriggerapoptosisingliomastemcells AT chenzhijie r406elicitsantiwarburgeffectviasykdependentandindependentmechanismstotriggerapoptosisingliomastemcells AT ouyangying r406elicitsantiwarburgeffectviasykdependentandindependentmechanismstotriggerapoptosisingliomastemcells AT zhangji r406elicitsantiwarburgeffectviasykdependentandindependentmechanismstotriggerapoptosisingliomastemcells AT maijialuo r406elicitsantiwarburgeffectviasykdependentandindependentmechanismstotriggerapoptosisingliomastemcells AT gujiayv r406elicitsantiwarburgeffectviasykdependentandindependentmechanismstotriggerapoptosisingliomastemcells AT luwanjun r406elicitsantiwarburgeffectviasykdependentandindependentmechanismstotriggerapoptosisingliomastemcells AT liuxincheng r406elicitsantiwarburgeffectviasykdependentandindependentmechanismstotriggerapoptosisingliomastemcells AT liuwenfeng r406elicitsantiwarburgeffectviasykdependentandindependentmechanismstotriggerapoptosisingliomastemcells AT shenglongxiang r406elicitsantiwarburgeffectviasykdependentandindependentmechanismstotriggerapoptosisingliomastemcells AT lubingzheng r406elicitsantiwarburgeffectviasykdependentandindependentmechanismstotriggerapoptosisingliomastemcells AT linyuan r406elicitsantiwarburgeffectviasykdependentandindependentmechanismstotriggerapoptosisingliomastemcells AT xingfan r406elicitsantiwarburgeffectviasykdependentandindependentmechanismstotriggerapoptosisingliomastemcells AT chenzhongping r406elicitsantiwarburgeffectviasykdependentandindependentmechanismstotriggerapoptosisingliomastemcells AT mouyonggao r406elicitsantiwarburgeffectviasykdependentandindependentmechanismstotriggerapoptosisingliomastemcells AT yanguangmei r406elicitsantiwarburgeffectviasykdependentandindependentmechanismstotriggerapoptosisingliomastemcells AT zhuwenbo r406elicitsantiwarburgeffectviasykdependentandindependentmechanismstotriggerapoptosisingliomastemcells AT saike r406elicitsantiwarburgeffectviasykdependentandindependentmechanismstotriggerapoptosisingliomastemcells |