Cargando…

Characterization of a relaxase belonging to the MOB(T) family, a widespread family in Firmicutes mediating the transfer of ICEs

BACKGROUND: Conjugative spread of antibiotic resistance and virulence genes in bacteria constitutes an important threat to public health. Beyond the well-known conjugative plasmids, recent genome analyses have shown that integrative and conjugative elements (ICEs) are the most widespread conjugative...

Descripción completa

Detalles Bibliográficos
Autores principales: Soler, Nicolas, Robert, Emilie, Chauvot de Beauchêne, Isaure, Monteiro, Philippe, Libante, Virginie, Maigret, Bernard, Staub, Johan, Ritchie, David W., Guédon, Gérard, Payot, Sophie, Devignes, Marie-Dominique, Leblond-Bourget, Nathalie
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2019
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6499999/
https://www.ncbi.nlm.nih.gov/pubmed/31073337
http://dx.doi.org/10.1186/s13100-019-0160-9
_version_ 1783415868226535424
author Soler, Nicolas
Robert, Emilie
Chauvot de Beauchêne, Isaure
Monteiro, Philippe
Libante, Virginie
Maigret, Bernard
Staub, Johan
Ritchie, David W.
Guédon, Gérard
Payot, Sophie
Devignes, Marie-Dominique
Leblond-Bourget, Nathalie
author_facet Soler, Nicolas
Robert, Emilie
Chauvot de Beauchêne, Isaure
Monteiro, Philippe
Libante, Virginie
Maigret, Bernard
Staub, Johan
Ritchie, David W.
Guédon, Gérard
Payot, Sophie
Devignes, Marie-Dominique
Leblond-Bourget, Nathalie
author_sort Soler, Nicolas
collection PubMed
description BACKGROUND: Conjugative spread of antibiotic resistance and virulence genes in bacteria constitutes an important threat to public health. Beyond the well-known conjugative plasmids, recent genome analyses have shown that integrative and conjugative elements (ICEs) are the most widespread conjugative elements, even if their transfer mechanism has been little studied until now. The initiator of conjugation is the relaxase, a protein catalyzing a site-specific nick on the origin of transfer (oriT) of the ICE. Besides canonical relaxases, recent studies revealed non-canonical ones, such as relaxases of the MOB(T) family that are related to rolling-circle replication proteins of the Rep_trans family. MOB(T) relaxases are encoded by ICEs of the ICESt3/ICEBs1/Tn916 superfamily, a superfamily widespread in Firmicutes, and frequently conferring antibiotic resistance. RESULTS: Here, we present the first biochemical and structural characterization of a MOB(T) relaxase: the RelSt3 relaxase encoded by ICESt3 from Streptococcus thermophilus. We identified the oriT region of ICESt3 and demonstrated that RelSt3 is required for its conjugative transfer. The purified RelSt3 protein is a stable dimer that provides a Mn(2+)-dependent single-stranded endonuclease activity. Sequence comparisons of MOB(T) relaxases led to the identification of MOB(T) conserved motifs. These motifs, together with the construction of a 3D model of the relaxase domain of RelSt3, allowed us to determine conserved residues of the RelSt3 active site. The involvement of these residues in DNA nicking activity was demonstrated by targeted mutagenesis. CONCLUSIONS: All together, this work argues in favor of MOB(T) being a full family of non-canonical relaxases. The biochemical and structural characterization of a MOB(T) member provides new insights on the molecular mechanism of conjugative transfer mediated by ICEs in Gram-positive bacteria. This could be a first step towards conceiving rational strategies to control gene transfer in these bacteria. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13100-019-0160-9) contains supplementary material, which is available to authorized users.
format Online
Article
Text
id pubmed-6499999
institution National Center for Biotechnology Information
language English
publishDate 2019
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-64999992019-05-09 Characterization of a relaxase belonging to the MOB(T) family, a widespread family in Firmicutes mediating the transfer of ICEs Soler, Nicolas Robert, Emilie Chauvot de Beauchêne, Isaure Monteiro, Philippe Libante, Virginie Maigret, Bernard Staub, Johan Ritchie, David W. Guédon, Gérard Payot, Sophie Devignes, Marie-Dominique Leblond-Bourget, Nathalie Mob DNA Research BACKGROUND: Conjugative spread of antibiotic resistance and virulence genes in bacteria constitutes an important threat to public health. Beyond the well-known conjugative plasmids, recent genome analyses have shown that integrative and conjugative elements (ICEs) are the most widespread conjugative elements, even if their transfer mechanism has been little studied until now. The initiator of conjugation is the relaxase, a protein catalyzing a site-specific nick on the origin of transfer (oriT) of the ICE. Besides canonical relaxases, recent studies revealed non-canonical ones, such as relaxases of the MOB(T) family that are related to rolling-circle replication proteins of the Rep_trans family. MOB(T) relaxases are encoded by ICEs of the ICESt3/ICEBs1/Tn916 superfamily, a superfamily widespread in Firmicutes, and frequently conferring antibiotic resistance. RESULTS: Here, we present the first biochemical and structural characterization of a MOB(T) relaxase: the RelSt3 relaxase encoded by ICESt3 from Streptococcus thermophilus. We identified the oriT region of ICESt3 and demonstrated that RelSt3 is required for its conjugative transfer. The purified RelSt3 protein is a stable dimer that provides a Mn(2+)-dependent single-stranded endonuclease activity. Sequence comparisons of MOB(T) relaxases led to the identification of MOB(T) conserved motifs. These motifs, together with the construction of a 3D model of the relaxase domain of RelSt3, allowed us to determine conserved residues of the RelSt3 active site. The involvement of these residues in DNA nicking activity was demonstrated by targeted mutagenesis. CONCLUSIONS: All together, this work argues in favor of MOB(T) being a full family of non-canonical relaxases. The biochemical and structural characterization of a MOB(T) member provides new insights on the molecular mechanism of conjugative transfer mediated by ICEs in Gram-positive bacteria. This could be a first step towards conceiving rational strategies to control gene transfer in these bacteria. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (10.1186/s13100-019-0160-9) contains supplementary material, which is available to authorized users. BioMed Central 2019-05-03 /pmc/articles/PMC6499999/ /pubmed/31073337 http://dx.doi.org/10.1186/s13100-019-0160-9 Text en © The Author(s). 2019 Open AccessThis article is distributed under the terms of the Creative Commons Attribution 4.0 International License (http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons license, and indicate if changes were made. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research
Soler, Nicolas
Robert, Emilie
Chauvot de Beauchêne, Isaure
Monteiro, Philippe
Libante, Virginie
Maigret, Bernard
Staub, Johan
Ritchie, David W.
Guédon, Gérard
Payot, Sophie
Devignes, Marie-Dominique
Leblond-Bourget, Nathalie
Characterization of a relaxase belonging to the MOB(T) family, a widespread family in Firmicutes mediating the transfer of ICEs
title Characterization of a relaxase belonging to the MOB(T) family, a widespread family in Firmicutes mediating the transfer of ICEs
title_full Characterization of a relaxase belonging to the MOB(T) family, a widespread family in Firmicutes mediating the transfer of ICEs
title_fullStr Characterization of a relaxase belonging to the MOB(T) family, a widespread family in Firmicutes mediating the transfer of ICEs
title_full_unstemmed Characterization of a relaxase belonging to the MOB(T) family, a widespread family in Firmicutes mediating the transfer of ICEs
title_short Characterization of a relaxase belonging to the MOB(T) family, a widespread family in Firmicutes mediating the transfer of ICEs
title_sort characterization of a relaxase belonging to the mob(t) family, a widespread family in firmicutes mediating the transfer of ices
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6499999/
https://www.ncbi.nlm.nih.gov/pubmed/31073337
http://dx.doi.org/10.1186/s13100-019-0160-9
work_keys_str_mv AT solernicolas characterizationofarelaxasebelongingtothemobtfamilyawidespreadfamilyinfirmicutesmediatingthetransferofices
AT robertemilie characterizationofarelaxasebelongingtothemobtfamilyawidespreadfamilyinfirmicutesmediatingthetransferofices
AT chauvotdebeaucheneisaure characterizationofarelaxasebelongingtothemobtfamilyawidespreadfamilyinfirmicutesmediatingthetransferofices
AT monteirophilippe characterizationofarelaxasebelongingtothemobtfamilyawidespreadfamilyinfirmicutesmediatingthetransferofices
AT libantevirginie characterizationofarelaxasebelongingtothemobtfamilyawidespreadfamilyinfirmicutesmediatingthetransferofices
AT maigretbernard characterizationofarelaxasebelongingtothemobtfamilyawidespreadfamilyinfirmicutesmediatingthetransferofices
AT staubjohan characterizationofarelaxasebelongingtothemobtfamilyawidespreadfamilyinfirmicutesmediatingthetransferofices
AT ritchiedavidw characterizationofarelaxasebelongingtothemobtfamilyawidespreadfamilyinfirmicutesmediatingthetransferofices
AT guedongerard characterizationofarelaxasebelongingtothemobtfamilyawidespreadfamilyinfirmicutesmediatingthetransferofices
AT payotsophie characterizationofarelaxasebelongingtothemobtfamilyawidespreadfamilyinfirmicutesmediatingthetransferofices
AT devignesmariedominique characterizationofarelaxasebelongingtothemobtfamilyawidespreadfamilyinfirmicutesmediatingthetransferofices
AT leblondbourgetnathalie characterizationofarelaxasebelongingtothemobtfamilyawidespreadfamilyinfirmicutesmediatingthetransferofices